Property Summary

NCBI Gene PubMed Count 98
PubMed Score 208.16
PubTator Score 184.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.100 1.3e-03
cutaneous lupus erythematosus 1.300 4.4e-03
osteosarcoma -2.240 5.0e-06
tuberculosis and treatment for 6 months -1.500 2.1e-04
lung cancer 1.900 3.8e-04
lung carcinoma -2.000 4.9e-19
mucosa-associated lymphoid tissue lympho... 2.199 1.9e-02
psoriasis 1.200 3.9e-40

Gene RIF (92)

PMID Text
26675069 we propose that expression of DNAM-1 on inflammatory monocytes are evolutionally conserved and act as an adhesion molecule on blood inflammatory monocytes.
26634488 CD226 rs763361 polymorphism was significantly associated with susceptibility to T1D.
26359290 Effector and regulatory CD4+ memory T cells of healthy individuals carrying the predisposing CD226 variant showed, in comparison to carriers of the protective variant, reduced surface expression of CD226 and impaired induction of CD226 after stimulation.
26109642 upregulated CD226 expression on CD8(+) T cells reflects disease severity and is involved in Systemic sclerosis pathogenesis via the production of various cytokines, including profibrotic IL-13 and endothelial cell injury
25994968 Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation.
25991472 Age and CMV serostatus influence the expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated natural killer cells.
25950680 DNAM-1 ligands CD112 and CD155 as well as the NKG2D ligands MICA and MICB were expressed on the hiPSC lines
25854581 NKG2D and DNAM-1 receptor-ligand interactions were essential in cytolysis by resting NK cells, as simultaneous blocking of both pathways resulted in almost complete abrogation of the cytotoxicity.
25825444 the coordinated expression of LFA-1 and DNAM-1 is a central component of NK cell education and provides a potential mechanism for controlling cytotoxicity by functionally mature NK cells.
25818301 our data reveal the existence of a functional program of NK cell maturation marked by DNAM-1 expression.
25684021 Data show that leucocyte function-associated antigen-1 (integrin alphaLbeta2), DNAX accessory molecule-1 (DNAM-1) or tumour necrosis factor-related apoptosis-inducing ligand (TRAIL) enhance osteoclast survival when co-cultured with activated NK cells.
25645050 genetic polymorphism is associated with rheumatoid arthritis, meta-analysis
25609078 The present study provides evidence that regulation of the PVR/CD155 DNAM-1 ligand expression by nitric oxide may represent an additional immune-mediated mechanism and supports the anti-myeloma activity of nitric oxide donors.
25597312 NKG2D and DNAM-1 ligand upregulation might sensitize B cells undergoing lytic Epstein-Barr virus replication to NK cell recognition. (Review)
25510399 These findings indicated that functional polymorphism rs727088A>G in CD226 might modify the susceptibility for the development of Gastric cancer.
25465800 Findings suggest that TIGIT is a key checkpoint inhibitor of chronic antiviral and antitumor responses through impairing CD226 function when disrupting its homodimerization.
25352670 CD112 downregulation resulted in a reduced ability of DNAM-1 to bind to the surface of both virus-infected and gD-transfected cells.
25209846 UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells.
25057181 The CD226 gene has been identified as novel association with JIA, and a SNP near CD28 as a suggestive association.
24891767 rs763361 variant of CD226 gene (TT genotype) is associated with susceptibility to type 1 diabetes, greater frequency of GAD65 autoantibody, and with the degree of aggressiveness of the disease in T1D patients from Brazil
24882570 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasms.
24769842 Downregulated NKG2D, NKp46, and DNAM-1 receptors associated with impaired NK cell effector function are important biomarkers of advanced disease with a poor prognosis in melanoma patients.
24673109 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24496997 XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells.
24451371 these results show that CD226 functions in immune synapse formation via its first extracellular domain.
23999715 CD226 rs763361, but not rs727088, gene polymorphism increased the risk of rheumatoid arthritis in a sample of the Iranian population.
23980210 The CD226/CD155 interaction regulates the proinflammatory (Th1/Th17)/anti-inflammatory (Th2) balance in humans.
23922043 While prior studies have found CD226 polymorphisms to be significantly associated with inflammatory demyelinating diseases, our results indicate the CD226 polymorphisms to be not associated with the diseases in Korean population.
23333304 HIV-1 Vif downregulates the expression of CD226 in Vif-expression T cells
23262348 The G allele and GG genotype of rs727088 polymorphism in CD226 gene contributes to increased Cervical Squamous Cell Carcinoma susceptibility in a Han Chinese population.
23161903 Overexpression of DNAM-1 was detected in the skin of patients with SSc (systemic sclerosis)
23073294 CD226 Gly307Ser (rs763361) is significantly associated with the risk of multiple autoimmune diseases.
22941566 This demonstrates the CD226 rs763361 polymorphism confers susceptibility to autoimmune disease in Europeans, South Americans and Asians
22547693 A soluble nectin-2 immunoglobulin-like V-set domain (nectin-2v) has been successfully prepared and demonstrates binding to both soluble ectodomain and cell surface-expressed full-length DNAX accessory molecule (DNAM)-1.
22531499 A CD226 three-variant haplotype is related with genetic predisposition to systemic sclerosis-related pulmonary fibrosis.
22512842 CD226 polymorphisms, rs727088, rs34794968 and rs763361 were not involved in giant cell arteritis susceptibility in the Spanish population.
22427644 TIGIT can inhibit T cell functions by competing with CD226 and can also directly inhibit T cells in a T cell-intrinsic manner.
22302395 CD226 gene polymorphisms may not be associated with rheumatoid arthritis susceptibility.
22301152 HIV-1 Vif downregulates the expression of CD226 in Vif-expression T cells
21525383 Study provides evidence that (pre)malignant cells themselves can acquire the ability to lyse epithelial cells via DNAM-1.
21521299 likely that the 307Ser variant of the CD226 receptor is associated with autoimmune polyendocrinopathy type 2 pathogenesis
21406724 NK cells lysed allogeneic proliferating more efficiently than nonproliferating T lymphocytes, with a mechanism requiring the cooperation between DNAM-1 and NKG2D.
21383766 Data indicate that NK cells from acute myeloid leukemia (AML) patients younger than 65 years have a reduced expression of DNAM-1 compared with age-matched controls.
21296979 The proportion of circulating CD226positive natural killer (NK) cells is reduced in patients with active systemic lupus erythematosus (SLE).
21286723 Demonstrate a genetic association between the CD226 gene and rheumatoid arthritis in a Chinese Han population with a potentially greater genetic effect than in the European population.
21162102 CD226 as a new systemic sclerosis genetic susceptibility factor underlying the contribution of costimulation pathways in the pathogenesis of systemic sclerosis.
20887380 An association between the Gly307Ser single nucleotide polymorphism (SNP) and susceptibility to systemic lupus erythemtosus was identified
20887380 Observational study of gene-disease association. (HuGE Navigator)
20669283 This study identified an association of CD226 with systemic lupus erythematosus in individuals of European ancestry.
20669283 Observational study of gene-disease association. (HuGE Navigator)
20613786 speculate that reduced expression of DNAM-1 on bone marrow natural killer cells may facilitate disease progression in patients with myelodysplastic syndrome
20508602 rs763361 in CD226 confers susceptibility for multiple sclerosis.
20508602 Observational study of gene-disease association. (HuGE Navigator)
20498205 Meta-analysis of gene-disease association. (HuGE Navigator)
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20399620 CD226 Gly307Ser gene polymorphism is associated with severity of psoriasis
20399620 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20338887 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20089178 The rs763361 SNP in the CD226 gene was associated with susceptibility to type 1 diabetes because disease-susceptible minor allele A maintains the wild type ESS sequence.
20080650 Observational study of gene-disease association. (HuGE Navigator)
20072139 Observational study of gene-disease association. (HuGE Navigator)
19951419 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19904767 Data show that pair-wise ligations of 2B4 with DNAM-1 and/or NKG2D lead to increased effector functions of primary CD4(+)CD28(-) T cells to suboptimal levels of anti-CD3 stimulation.
19865102 Observational study of gene-disease association. (HuGE Navigator)
19801517 evidence provided for the contribution of DNAM-1/CD155 interactions to the reduction of DNAM-1 expression, suggesting that chronic receptor-ligand interactions in the tumor environment may induce loss of DNAM-1 on tumor-associated NK cells.
19690890 Observational study of gene-disease association. (HuGE Navigator)
19624611 CD226 gene as a susceptible candidate locus for type 1 diabetes outside the major histocompatibility complex region.
19624611 Observational study of gene-disease association. (HuGE Navigator)
19580844 In the presence of DC-derived cytokines such as interleukin-12, in both patients & healthy individuals, DNAM-1 can cooperate with NKp30 to induce NK cells to kill DC, release tumor necrosis factor-alpha, & promote DC maturation.
19536154 CD226 Gly307Ser polymorphism is associated with Wegener's granulomatosis and multiple sclerosis.
19536154 Observational study of gene-disease association. (HuGE Navigator)
19380793 CD226-transgenic mice display enlarged thymus lobes resulting from increased thymus cellularity.
18987646 CD226 is a multiple sclerosis susceptibility gene.
18987646 Observational study of gene-disease association. (HuGE Navigator)
18971939 CD226 Gly307Ser association with multiple autoimmune diseases is reported.
18971939 Observational study of gene-disease association. (HuGE Navigator)
18657862 EWS tumor cells are recognized and lysed by resting and with higher efficacy by activated NK cells through NKG2D and DNAM-1 dependent pathways.
17875681 NK cell-mediated killing of myeloma cell lines was dependent on either DNAM-1 or NKG2D but not both molecules.
16987076 expression on CD3+, CD4+, and CD8+ T cells and on CD3- CD16+ NK cells of HIV-infected patients was significantly higher than that of normal controls.
16887814 CD226 promoters P1 and P2 are regulated by Ets-1 and AP-1
16831868 CD226/CD112 (DNAM-1/Nectin-2) mast cell stimulation has a role in the allergic process
16388732 The cytotoxicity of NK cells enhanced by SEA or SEB may be correlation with the increased expression of CD226 molecule, and CD226 may be involved in synapse formation of NK cells at killing stage.
16015041 Loss of Dnam-1 gene copy number and retention of Cadh-7 might be indicators of worse prognosis, and Dnam-1 deletion might predict for a beneficial response to adjuvant 5-FU-based chemotherapy in patients with colorectal cancer.
15693793 CD226 molecules play an important role in maturation of the megakaryocytes in combination with LFA-1
15138281 PTA-1(CD226 antigen) is localized to membrane rafts and binds the carboxyl-terminal domain of isoforms of the actin-binding protein 4.1G and also can bind human discs large providing the structural basis for a regulated molecular adhesive complex
15136589 DNAM-1 regulates monocyte extravasation via its interaction with cd155 protein expressed at endothelial junctions on normal cells.
14676297 CD226 is involved in LFA-1-mediated costimulatory signals for triggering naive T cell differentiation and proliferation.
12913096 Data show that both PVR and Nectin-2 represent specific ligands for the DNAM-1 triggering receptor.
12847109 CD226 mediates platelet and megakaryocytic cell adhesion to vascular endothelial cells

AA Sequence

MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMV      1 - 70
IRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHI     71 - 140
VSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIP    141 - 210
DVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRR    211 - 280
RERRDLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV                  281 - 336
//

Text Mined References (102)

PMID Year Title
26755705 2016 Identification of CD112R as a novel checkpoint for human T cells.
26675069 2016 Expression of DNAM-1 (CD226) on inflammatory monocytes.
26634488 2015 Association of CD226 polymorphisms with the susceptibility to type 1 diabetes in Chinese children.
26359290 2015 Multiple sclerosis associated genetic variants of CD226 impair regulatory T cell function.
26109642 2015 Increased CD226 Expression on CD8+ T Cells Is Associated with Upregulated Cytokine Production and Endothelial Cell Injury in Patients with Systemic Sclerosis.
25994968 2015 Divergent Phenotypes of Human Regulatory T Cells Expressing the Receptors TIGIT and CD226.
25991472 2015 Expression of NKp30, NKp46 and DNAM-1 activating receptors on resting and IL-2 activated NK cells from healthy donors according to CMV-serostatus and age.
25950680 2015 Human Induced Pluripotent Stem Cells Are Targets for Allogeneic and Autologous Natural Killer (NK) Cells and Killing Is Partly Mediated by the Activating NK Receptor DNAM-1.
25854581 2015 Role of NKG2D, DNAM-1 and natural cytotoxicity receptors in cytotoxicity toward rhabdomyosarcoma cell lines mediated by resting and IL-15-activated human natural killer cells.
25825444 2015 Coordinated expression of DNAM-1 and LFA-1 in educated NK cells.
25818301 2015 DNAM-1 expression marks an alternative program of NK cell maturation.
25684021 2015 Interleukin-15-activated natural killer cells kill autologous osteoclasts via LFA-1, DNAM-1 and TRAIL, and inhibit osteoclast-mediated bone erosion in vitro.
25645050 2015 Association between the CTLA-4, CD226, FAS polymorphisms and rheumatoid arthritis susceptibility: a meta-analysis.
25609078 2015 Nitric oxide donors increase PVR/CD155 DNAM-1 ligand expression in multiple myeloma cells: role of DNA damage response activation.
25597312 2014 Role of human natural killer cells during Epstein-Barr virus infection.
25510399 2015 CD226 rs727088A>G polymorphism increases the susceptibility to gastric cancer in Chinese populations.
25465800 2014 The immunoreceptor TIGIT regulates antitumor and antiviral CD8(+) T cell effector function.
25352670 2014 Modulation of CD112 by the alphaherpesvirus gD protein suppresses DNAM-1-dependent NK cell-mediated lysis of infected cells.
25209846 2014 UPR decreases CD226 ligand CD155 expression and sensitivity to NK cell-mediated cytotoxicity in hepatoma cells.
25057181 2015 CD226 (DNAM-1) is associated with susceptibility to juvenile idiopathic arthritis.
24891767 2014 CD226 rs763361 is associated with the susceptibility to type 1 diabetes and greater frequency of GAD65 autoantibody in a Brazilian cohort.
24882570 2014 Up-regulation of DNAM-1 and NKp30, associated with improvement of NK cells activation after long-term culture of mononuclear cells from patients with ovarian neoplasia.
24769842 2014 Decreased expression of NKG2D, NKp46, DNAM-1 receptors, and intracellular perforin and STAT-1 effector molecules in NK cells and their dim and bright subsets in metastatic melanoma patients.
24673109 2014 Balance between activating NKG2D, DNAM-1, NKp44 and NKp46 and inhibitory CD94/NKG2A receptors determine natural killer degranulation towards rheumatoid arthritis synovial fibroblasts.
24496997 2014 XLP1 inhibitory effect by 2B4 does not affect DNAM-1 and NKG2D activating pathways in NK cells.
24451371 2014 CD226 protein is involved in immune synapse formation and triggers Natural Killer (NK) cell activation via its first extracellular domain.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23999715 2013 CD226 rs763361 (Gly307Ser) polymorphism is associated with susceptibility to rheumatoid arthritis in Zahedan, southeast Iran.
23980210 2013 The CD226/CD155 interaction regulates the proinflammatory (Th1/Th17)/anti-inflammatory (Th2) balance in humans.
23922043 2013 Lack of association between CD226 genetic variants and inflammatory demyelinating diseases in Korean population.
23262348 2013 Association between two genetic variants of CD226 gene and Cervical Squamous Cell Carcinoma: a case-control study.
23161903 2013 Critical role of the adhesion receptor DNAX accessory molecule-1 (DNAM-1) in the development of inflammation-driven dermal fibrosis in a mouse model of systemic sclerosis.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23073294 2013 CD226 Gly307Ser association with multiple autoimmune diseases: a meta-analysis.
22941566 2012 Association between the CD226 rs763361 polymorphism and susceptibility to autoimmune diseases: a meta-analysis.
22547693 2012 Crystal structure of cell adhesion molecule nectin-2/CD112 and its binding to immune receptor DNAM-1/CD226.
22531499 2012 A multicenter study confirms CD226 gene association with systemic sclerosis-related pulmonary fibrosis.
22512842 Autoimmune disease-associated CD226 gene variants are not involved in giant cell arteritis susceptibility in the Spanish population.
22427644 2012 The TIGIT/CD226 axis regulates human T cell function.
22302395 2012 Influence of MIF, CD40, and CD226 polymorphisms on risk of rheumatoid arthritis.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21829393 2011 Genome-wide association analysis of autoantibody positivity in type 1 diabetes cases.
21525383 2011 DNAM-1 mediates epithelial cell-specific cytotoxicity of aberrant intraepithelial lymphocyte lines from refractory celiac disease type II patients.
21521299 2011 The role of a nonsynonymous CD226 (DNAX-accessory molecule-1) variant (Gly 307Ser) in isolated Addison's disease and autoimmune polyendocrinopathy type 2 pathogenesis.
21406724 2011 DNAM-1 ligand expression on Ag-stimulated T lymphocytes is mediated by ROS-dependent activation of DNA-damage response: relevance for NK-T cell interaction.
21383766 2012 Decreased expression of DNAM-1 on NK cells from acute myeloid leukemia patients.
21296979 2011 Involvement of CD226+ NK cells in immunopathogenesis of systemic lupus erythematosus.
21286723 2012 The CD226 gene in susceptibility of rheumatoid arthritis in the Chinese Han population.
21162102 2011 Association of the CD226 Ser(307) variant with systemic sclerosis: evidence of a contribution of costimulation pathways in systemic sclerosis pathogenesis.
20887380 2011 Association of the CD226 single nucleotide polymorphism with systemic lupus erythematosus in the Chinese Han population.
20669283 2010 A 3'-untranslated region variant is associated with impaired expression of CD226 in T and natural killer T cells and is associated with susceptibility to systemic lupus erythematosus.
20613786 2010 Reduced DNAM-1 expression on bone marrow NK cells associated with impaired killing of CD34+ blasts in myelodysplastic syndrome.
20508602 2010 The autoimmune disease-associated KIF5A, CD226 and SH2B3 gene variants confer susceptibility for multiple sclerosis.
20498205 2010 Investigation of potential non-HLA rheumatoid arthritis susceptibility loci in a European cohort increases the evidence for nine markers.
20444755 2010 Investigation of rheumatoid arthritis susceptibility genes identifies association of AFF3 and CD226 variants with response to anti-tumour necrosis factor treatment.
20399620 2010 The CD226 Gly307Ser gene polymorphism is associated with severity of psoriasis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20338887 2010 Non-synonymous variant (Gly307Ser) in CD226 is associated with susceptibility to multiple autoimmune diseases.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219786 2011 The role of rheumatoid arthritis genetic susceptibility markers in the prediction of erosive disease in patients with early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20089178 2010 Allelic variants in the PHTF1-PTPN22, C12orf30 and CD226 regions as candidate susceptibility factors for the type 1 diabetes in the Estonian population.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
20072139 2010 Association of the AFF3 gene and IL2/IL21 gene region with juvenile idiopathic arthritis.
19951419 2009 Confirmation of the genetic association of CTLA4 and PTPN22 with ANCA-associated vasculitis.
19904767 2010 Activating NK-cell receptors co-stimulate CD4(+)CD28(-) T cells in patients with rheumatoid arthritis.
19865102 2010 Multiple sclerosis susceptibility alleles in African Americans.
19820697 2009 A genome-wide meta-analysis identifies 22 loci associated with eight hematological parameters in the HaemGen consortium.
19801517 2009 Primary human tumor cells expressing CD155 impair tumor targeting by down-regulating DNAM-1 on NK cells.
19690890 2009 Genetic analysis of diabetic nephropathy on chromosome 18 in African Americans: linkage analysis and dense SNP mapping.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19624611 2009 The CD226 gene in susceptibility of type 1 diabetes.
19580844 2009 Analysis of NK cell/DC interaction in NK-type lymphoproliferative disease of granular lymphocytes (LDGL): role of DNAM-1 and NKp30.
19536154 2009 Novel association of the CD226 (DNAM-1) Gly307Ser polymorphism in Wegener's granulomatosis and confirmation for multiple sclerosis in German patients.
19380793 2009 Expression of CD226 antagonizes apoptotic cell death in murine thymocytes.
18987646 2009 The expanding genetic overlap between multiple sclerosis and type I diabetes.
18971939 2009 CD226 Gly307Ser association with multiple autoimmune diseases.
18657862 2008 NK cells recognize and lyse Ewing sarcoma cells through NKG2D and DNAM-1 receptor dependent pathways.
18088087 2008 Phosphoproteome of resting human platelets.
17875681 2007 The requirement for DNAM-1, NKG2D, and NKp46 in the natural killer cell-mediated killing of myeloma cells.
17554260 2007 Robust associations of four new chromosome regions from genome-wide analyses of type 1 diabetes.
16987076 2006 Expression of human CD226 on T cells and natural killer cells and of soluble CD226 in plasma of HIV-1-infected Chinese patients.
16887814 2006 Identification and characterization of the CD226 gene promoter.
16831868 2006 Mast cell costimulation by CD226/CD112 (DNAM-1/Nectin-2): a novel interface in the allergic process.
16388732 2006 [Expression and function of CD226 on NK cells activated by Superantigens].
16304049 2006 Expression of the DNAM-1 ligands, Nectin-2 (CD112) and poliovirus receptor (CD155), on dendritic cells: relevance for natural killer-dendritic cell interaction.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16015041 2005 Prognostic and predictive relevance of DNAM-1, SOCS6 and CADH-7 genes on chromosome 18q in colorectal cancer.
15693793 2005 CD226 is expressed on the megakaryocytic lineage from hematopoietic stem cells/progenitor cells and involved in its polyploidization.
15607800 2005 PVR (CD155) and Nectin-2 (CD112) as ligands of the human DNAM-1 (CD226) activating receptor: involvement in tumor cell lysis.
15536144 2005 Analysis of the receptor-ligand interactions in the natural killer-mediated lysis of freshly isolated myeloid or lymphoblastic leukemias: evidence for the involvement of the Poliovirus receptor (CD155) and Nectin-2 (CD112).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15138281 2004 The LFA-1-associated molecule PTA-1 (CD226) on T cells forms a dynamic molecular complex with protein 4.1G and human discs large.
15136589 2004 DNAM-1 and PVR regulate monocyte migration through endothelial junctions.
15039383 2004 Functional characterization of DNAM-1 (CD226) interaction with its ligands PVR (CD155) and nectin-2 (PRR-2/CD112).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676297 2003 CD226 (DNAM-1) is involved in lymphocyte function-associated antigen 1 costimulatory signal for naive T cell differentiation and proliferation.
12913096 2003 Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule.
12847109 2003 CD226 mediates platelet and megakaryocytic cell adhesion to vascular endothelial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591186 1999 Physical and functional association of LFA-1 with DNAM-1 adhesion molecule.
8673704 1996 DNAM-1, a novel adhesion molecule involved in the cytolytic function of T lymphocytes.