Property Summary

NCBI Gene PubMed Count 49
PubMed Score 263.94
PubTator Score 346.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis 1.100 4.8e-03
group 3 medulloblastoma -1.100 3.3e-02
medulloblastoma, large-cell 1.400 1.5e-04
ovarian cancer 1.500 4.2e-09
psoriasis 1.200 1.0e-05

PDB (14)

Gene RIF (29)

AA Sequence

MLLLPFQLLAVLFPGGNSEHAFQGPTSFHVIQTSSFTNSTWAQTQGSGWLDDLQIHGWDSDSGTAIFLKP      1 - 70
WSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLD     71 - 140
FLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKADLQRQVKPEAWLS    141 - 210
SGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCR    211 - 280
VKHSSLEGQDIILYWRNPTSIGSIVLAIIVPSLLLLLCLALWYMRRRSYQNIP                     281 - 333
//

Text Mined References (51)

PMID Year Title