Property Summary

NCBI Gene PubMed Count 649
PubMed Score 102.03
PubTator Score 2951.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Paroxysmal nocturnal hemoglobinuria 11 3.351 1.7

Expression

 CSPA Cell Line (2)

Gene RIF (713)

PMID Text
27031691 Mean neopterin and soluble CD14 levels among those with the indeterminate HIV-1 pattern were significantly lower than among the true HIV-1-positive infection.
26927558 Data indicate that in recurrent spontaneous abortion patients, the expression levels of CD49b and LAG-3 (CD223) on CD14(+) mononuclear cells and the plasma level of transforming growth factor beta (TGF-beta) decreased obviously compared with normal females.
26827181 Genetic variation in MORC4, CD14, and TLR4 may affect the outcome of allogeneic stem cell transplantation.
26658828 PAR-2 expression is increased on CD14++CD16+ monocytes in the peripheral blood of subjects with severe asthma and may be a biomarker of asthma severity.
26569178 The correlation of CD antigens with cytomegalovirus (CMV) antibodies in HIV positive people showed that increased CD163 but not CD14 is a marker of CMV infection.
26475135 We found that the frequency of CD14 AA genotype was significantly higher in asthmatic children compared to healthy controls. Asthmatic children carrying GG genotype had a significantly lower prevalence of atopic asthma
26462562 There is evidence for association of gout with functional variants in CARD8, IL1B and CD14.
26443598 There was an increased odds of vertical transmission of HIV for every log2 increase in maternal sCD14 concentration, after adjustment for maternal HIV load, CD4 count and anti-HIV agent exposure.
26437765 Genetic variants of NOS3, CD14, MMP3 and IL4R are implicated in the determination of VEGF expression and plasma levels.
26365205 Association between CD14 gene promoter polymorphisms with serum total-IgE and eosinophil levels in atopic and non-atopic asthma patients in a Chinese Han population
26296897 presepsin (sCD14-ST) as a diagnostic and prognostic marker of sepsis in the emergency department
26161395 the combination of high levels of CD14, FOXP3, and ARG1 mRNAs identified a small group of patients with excellent event-free and overall survival.
26135617 therapy with rituximab, cyclophosphamide and fludarabine resulted in a significant reduction in the number of non-classical CD14+CD16++ monocytes and soluble form of CD163 but upregulation of membrane-associated monocyte CD163
26081375 Knockdown of CD14 expression reduces the inflammation response of tumor cells to lipopolysaccharide stimulation.
26030716 Elevated presepsin levels are associated with chronic kidney disease.
26020644 CD14 rs2569190 may act as a prognostic variable for the short-term outcome (30-day survival) in patients with sepsis.
25970945 Presepsin has diagnostic value, early prognostic value and is an early marker of mortality in septic patients.
25966203 The data suggest that the CD14 TT genotype may be a genetic susceptibility marker for atopic asthma in Chinese Han children.
25907631 Data show that combined inhibition of complement 3 and 5 and CD14 antigen significantly reduced E. coli-induced cytokines.
25854904 CD64 index, CRP and sCD14-ST served as good parameters to determine possible infection in patients that needed intensive care after major procedures.
25825750 Data indicate that CD14 antigen-high bladder cancer (BC) cells may orchestrate tumor-promoting inflammation and drive tumor cell proliferation to promote tumor growth.
25811314 the relationship between soluble CD14 concentration and disease progression, as well as the response to pegylated interferon/ribavirin (peg-IFN/RBV) therapy in Egyptian patients with chronic hepatitis C, was investigated.
25792471 The frequency of CD14(+)HLA-DR-/low MDSCs could be considered as a poor prognostic predictor in small-cell lung cancer (SCLC) and the elimination of MDSCs during medical interventions may improve the prognosis of SCLC patients.
25766482 anti-neutrophil cytoplasm antibody associated vasculitis patients exhibit increased CD14 expression on monocytes during active disease.
25722986 Thus plasma presepsin levels have comparable performance in systemic inflammatory response syndrome for patients with nephrolithiasis.
25695487 CD14+HLA-DR(-/low) cells were significantly increased in gastric cancer tissue and were shown to have a critical role in CD4+T-cell immunosuppression.
25672468 Determination of reference interval for presepsin, an early marker for sepsis.
25660311 HMGB1 plays an important role in LTA-mediated inflammation by binding to and transferring LTA to CD14, which is subsequently transferred to TLR2 to induce an inflammatory response.
25647501 The data suggest that elevated extracellular dopamine in the CNS of HIV infected drug abusers contributes to HIV neuropathogenesis by increasing the accumulation of CD14+CD16+ monocytes in dopamine rich brain regions.
25636826 sCD14 from plasma contributes to LPS/TLR4 signalling in platelets to allow significant release of soluble CD40L, thereby elucidating the mechanism of LPS-induced platelet responses and providing new insights for reducing LPS toxicity in the circulation.
25633197 CD14-mediated lipid signaling induced epithelial apoptosis, whereas TLR4 antagonistically promoted cell survival and cancer development.
25622527 The CD14 C-260T single nucleotide polymorphism was associated with increased monocyte activation but not systemic inflammation.
25572736 CD14 may have a functional role in the viral conjunction to the structural complex TLR4/CD14.
25562385 monocyte activation as measured by sCD14 is associated with obesity-related vascular dysfunction
25497142 27OHChol can prime monocytes/macrophages by up-regulation of CD14 such that LPS-mediated inflammatory reaction is accelerated, thereby contributing to aggravated development of atherosclerotic lesions.
25432966 high levels in breast milk 3 mo post-partum are associated with children developing an IgE-mediated allergic disorder by the age of 5 yr
25431457 2'-fucosyllactose directly inhibits lipopolysaccharide-mediated inflammation during E. coli infection of intestinal epithelial cells through attenuation of CD14 induction.
25416051 Overexpression of B7-H3 in CD14+ monocytes is associated with renal cell carcinoma progression.B7-H3 might play an important role in angiogenesis of renal cell carcinoma mediated by CD14(+) monocytes.
25394369 Results show that rs11536889 polymorphism in TLR4 and rs2563298 polymorphism in CD14, as well as two haplotypes were associated with increased susceptibility to sepsis.
25387303 The prognosis and severity of infection may be assessed more accurately by measuring the presepsin levels until day 7. Presepsin is a useful diagnostic tool for infectious disseminated intravascular coagulation.
25309126 Presepsin level can be a reliable indicator of sepsis among non-acute kidney injury patients
25238263 Il-6-induced recruitment of CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells is associated with progression and poor prognosis in squamous cell carcinoma of the esophagus.
25108076 In 8-yr-olds, CD14 levels were positively related to common carotid intima-media thickness, indicating inflammatory vascular alterations inflicted by extracellular vesicle protein CD14 already in early life .
25091944 The C-159T polymorphism in CD14 gene is associated with increased risk of tuberculosis, especially in Asians, but not in Caucasians.
25063948 Adjusting for body mass index and waist circumference, sCD14 levels remained significantly increased in metabolic syndrome and increased with increasing numbers of MetS risk factors. sCD14 correlated with monocyte TLR4 protein and activity.
25059667 Data indicate that glycosylphosphatidylinositol-anchored glycoprotein CD14 controls Toll-like receptor-4 (TLR4)-mediated signaling through the ligation with sialic acid-binding lectin 3 (CD33).
25046588 Macrophage CD14 expression in human carotid plaques is associated with complicated lesions, correlates with thrombosis, and is reduced by angiotensin receptor blocker treatment
25034561 the effect of bacterial colonisation of the upper airways and serum Treg on asthma development at 6 years of age may be affected by genetic variants in the TLRs and CD14 genes
25001428 Elevated maternal serum concentration of sCD14-ST could be an independent and relevant risk factor for preterm delivery.
24978812 CD14 -260C/T polymorphism may increase the risk of gastric cancer in H. pylori-infected individuals. (Meta-analysis)
24933321 DC-HIL+ CD14+ HLA-DR no/low cells are a potential blood marker and therapeutic target for melanoma
24908235 Rosiglitazone treatment induced substantial decrease of CD14 in type 2 diabetic patients.
24902762 genetic polymorphism is associated with asthma exacerbations in children
24897401 Presepsin as a potential marker for bacterial infection relapse in critical care patients
24891322 Mechanistically, mDia1 deficiency led to a downregulation of membrane-associated genes and a specific upregulation of CD14 messenger RNA in granulocytes, but not in other lineages.
24870592 Studies suggest that CD14-260C/T polymorphism might be a protective factor for hematological malignance and prostate tumor susceptibility but not an independent risk factor for gastrointestinal cancer susceptibility.
24697307 The LPS-mediated activation in mast cells may be provoked by soluble CD14 distributed by other LPS-triggered cells at the gastrointestinal barrier.
24691204 Soluble CD14 is independently associated with coronary artery calcification, and, among those with detectable calcium, predicts the extent of subclinical disease in other vascular beds.
24659539 Striking differences were found between human and mouse astrocytes expressing CD14.
24636145 Increased CD14+ monocytes with loss of HLA-DR expression were seen in patients with higher stage disease, more aggressive pathology, and in relapse or refractoriness to treatment.
24627605 CD14/-260 polymorphism is associated with gastric cancer risk in Highland Tibetans and affects CD14 promoter activity, thereby regulating CD14 expression.
24622882 CHB patients display reduced TLR9 expression on peripheral CD14+ monocytes, which is independent of host and viral markers, and on liver tissue.
24612386 TLR2 and its co-receptors, TLR1 and TLR6, contribute to the pathogenicity of aPLA; aPLA are internalized via clathrin- and CD14-dependent endocytosis; and endocytosis is required for NF-kappaB activation
24586701 High Plasma soluble CD14 is associated with pulmonary exacerbations in cystic fibrosis.
24581860 Four genes showed increased expression in the epithelium of OLP patients: CD14, CXCL1, IL8, and TLR1, and at least two of these proteins, TLR1 and CXCL1, were expressed at substantial levels in oral keratinocytes.
24519436 The results from this meta-analysis indicate that CD14 -159C/T polymorphism is associated with TB predisposition and may serve as a candidate of susceptibility biomarker for TB.
24516199 Data indicate that inhibiting complement C3 and C5 and CD14 efficiently attenuated S. aureus-induced inflammation and might be a promising treatment in both Gram-negative and Gram-positive sepsis.
24461398 Data from the present study suggest that polymorphisms in the CD14 genes do not influence the response to endodontic treatment of teeth with apical periodontitis.
24419414 High CD14 expression is associated with metastasis and recurrence in non-small-cell lung cancer.
24401216 reduced CD14 expression may have a role in increased carotid artery intima media thickness among HIV-infected adults on long-term ART
24398371 Extracellular vesicle derived CD14 levels are strongly correlated to the extent of vascular disease, but not specifically to markers that reflect atherosclerosis burden, in patients with manifest cardiovascular disease.
24393424 Presepsin levels predict mortality in patients with sepsis.
24347797 CD14 variants are important for the expression of croup and asthma but not atopy.
24333662 CD14(bright)CD16(low) intermediate monocytes expressing Tie2 are increased in the peripheral blood of patients with primary myelofibrosis.
24314935 TLR4 (Asp299Gly) and CD14 (C/T -159) functional SNPs do not play a major role in acute graft rejection, chronic allograft nephropathy, and kidney graft survival.
24275652 Data indicate that blockade of CD14 inhibits TLR4 internalization, spleen tyrosine kinase (Syk) phosphorylation and IRF3 signaling in epithelial cells.
24172224 these results suggest that membrane CD14 ligation-mediated TLR4 internalization is a novel mechanism for effective down-regulation of surface expression of TLR4 and subsequent reduction of LPS response of human monocytes.
24170183 The CD14-159C/T polymorphism is not associated with allergic rhinitis risk. [Meta-Analysis]
24147858 no association between genetic variants and measles vaccine response in children from Australia and Mozambique
24144680 Genetical variations in the innate immune system by polymorphisms in the CD14, could be related with an increases susceptibility to severe invasive infections by S. pneumoniae and N. meningitidis
24125453 CD14-159C/T contributes to tuberculosis susceptibility; the T-allele and TT homozygosis are potential risk factors, particularly in Asians.
24116867 VB-201 may counter inflammation where TLR-2 and/or CD14 complicity is essential, and is therefore beneficial for the treatment of atherosclerosis.
24086515 Serum soluble CD14 is a potential prognostic indicator of recurrence of human breast invasive ductal carcinoma with Her2-enriched subtype.
24077340 Inflammatory gene polymorphisms were not associated with arterial stiffness.
24076253 presepsin concentrations increase with age and kidney dysfunction
24074718 Plasma presepsin (CD14 fragment) was significantly increased in burn patients with sepsis comparted to those without.
24068451 CD14 recognizes and binds to Mycoplasma genitalium LAMPs to upregulate TNF-alpha release.
24064911 CD14 promoted tumor cell EMT and invasion through TNF-alpha, whereas knockdown of CD14 expression inhibited gastric cancer cell invasion and EMT.
24046527 Meta-analysis suggests that the -159C/T polymorphism in the CD14 gene contributes to tuberculosis susceptibility
24044964 The present study indicated that CD14 gene polymorphisms may contribute to susceptibility to atopy in Egyptian children and influenced with tobacco smoke exposure.
23990939 The CD14-159C/T polymorphism may not be a significant susceptibility factor in the risk of sepsis and mortality. [meta-analysis]
23936239 CD14 relies on residue 11 for apoptotic cell tethering and it may be an important tethering molecule on so called 'non-professional' phagocytes thus contributing to apoptotic cell clearance in a non-myeloid setting.
23880187 CD14 and TLR4 mediate cytokine release induced by LDL(-) in human monocytes.
23824692 we conclude that genetic variation in NOD2 associates with noncardia gastric cancer while variation in CD14 is associated with cardia gastric cancer.
23796347 CD14 rs2569190 polymorphism was not associated with oral cancer risk in our study.
23786414 Biologically relevant levels of mixed AFs elicited early immune modulation in human PBMCs. qRT-PCR results showed several folds increase of MyD88, TLR2, TLR4 and CD14 transcripts in PBMCs
23770267 Studied the association between CD14--159C/T polymorphisms and the risks of tuberculosis. This meta-analysis suggests a possible association between CD14--59C/T polymorphism and TB risks in Asians, but not in Caucasians.
23762319 serum soluble CD14 levels increased significantly with increasing liver inflammation grade in patients with nonalcoholic fatty liver disease.
23748193 Greater adiposity is associated with higher MIP-1alpha and lower soluble CD14 levels, possibly reflecting an important role for cells of the monocyte/macrophage lineage.
23741383 CD14 gene (-159 C>T) polymorphism confers increased susceptibility to tuberculosis. (Meta-analysis)
23679818 Data show that IFN-gamma induced the production of IL-12/23p40 and IL-23p19 mRNA as well as IL-12p40 and IL-23 proteins positively regulated by the p38 mitogen-activated protein kinases (MAPKs) in monocytes
23589304 Lgr4/Gpr48 negatively regulates TLR2/4-associated pattern recognition and innate immunity by targeting CD14 expression.
23587862 the CD14-159C>T polymorphism may not be significantly associated with the risk for alcoholic liver disease(Meta-Analysis)
23582034 2 common CD14 polymorphisms, C-159T and C-260T, have no association with the likelihood of periodontitis
23565226 based on our ethnic Chinese case-control study and meta-analysis, TLR2 -196 to -174del, TLR4 Asp299Gly, TLR4 rs11536889 and CD14 -260 C/T polymorphisms appear to play an important role in the development of gastric cancer.
23537804 CD14 expression in aorta and plasma CD14 levels were increased in abdominal aortic aneurysm patients compared with controls.
23517107 The present meta-analysis provided confirmative evidence that CD14 -159 C>T was involved in the development of periodontitis
23510625 The aim of this study was to evaluate diagnostic value of soluble biomarkers (CD14 subtype, interleukin-2 receptor, HLA-G) and procalcitonin in the identification of infectious process at the beginning of a febrile episode in pediatric oncology patients.
23430250 Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex
23371544 CD14 expression on leukemic blasts is an independent prognostic factor for survival outcomes in patients with AML arising from MDS.
23338226 The tumor-suppressive role of CD14 in gastric cancer. CD14 overexpression activated NF-kappaB via upregulating its expression and simultaneously stimulating DNA binding activity.
23277403 The CD14 C-260T polymorphism is a risk factor of coronary heart disease, especially in East Asians.
23264655 The x-ray crystal structure of human CD14 contains an expanded pocket and alternative rim residues that are likely to be important for LPS binding and cell activation. .
23206327 This study analysis revealed up-regulation of CD14, CD18, CD45, TLR2, TLR4, CD74, C1q, C3, CCL2, and down-regulation of CD36, CX3CR1, CX3CL1 and CD200 in postmenopausal women
23201091 These studies show for the first time that lipopolysaccharide causes an increase in intestinal permeability via an intracellular mechanism involving TLR-4-dependent up-regulation of CD14 membrane expression.
23194293 Pet keeping and tobacco smoke exposure small were associated with a smaller increase in CD14 methylation during childhood and lower CD14 methylation at 10 yr., indicating a CD14 gene-environemnt interaction.
23162132 Human CD14+ dermal-derived dendritic cells respond to selected Toll-like receptor (TLR) ligand combinations via their phenotypic maturation, release of cytokines, and capacity to stimulate naive B and CD4+ T cells.
23162014 CD14 independently predicts risk mortality in older adults.
23146639 No statistically significant association emerged between the CD14 C(-260)T and the CD14 C(-159)T polymorphism, endodontic or periodontal disease, and CHD. Chronic oral diseases may increase the risk of CHD and may be an unconventional risk factor for CHD.
23135962 The IL6 -174G>C and CD14 -260C>T polymorphisms are likely to be associated with a pro-atherogenic profile but not with increased inflammatory markers and endothelial dysfunction in young AMI patients.
23121673 chronic T cell activation in common variable immunodeficiency (CVID) is associated with elevated levels of sCD14 and sCD25.
23107636 data indicate that the C-159T polymorphism of the CD14 gene is associated with tuberculosis(TB); serum sCD14 levels were higher in TB patients in a sample of the Iranian population
23101184 A genetic variation in the CD14 promoter might play a role in the pathogenesis of nasal polyposis and in the incidence of asthma.
23079836 G(-1145)A and C(-159)T polymorphisms of CD14 are associated with decreased risk for the development of tuberculosis in the Chinese Han population.
23049772 The CD14 gene C260T polymorphism might be a promising candidate marker in susceptibility to ulcerative colitis, especially in Asians.
23046822 The association between periodontitis and one polymorphic site on both DEFB1 and CD14 gene, was investigated.
23036271 The genotyping findings of the present study do not support a role for the CD14-159C/T polymorphism in the development of tuberculosis, at least in the geographical region of central Anatolia
23036097 interaction between CD14 and TNF-alpha single nucleotide polymorphisms influences the survival of critically ill patients
23009036 in Greek patients with alcohol abuse and alcoholic cirrhosis, a significant negative association with the CD14 endotoxin receptor gene polymorphism (TT genotype) was found.
23000519 These results suggest that protosapanin A has anti-oxidative/nitrative activities on brain immune and neuroinflammation through regulation of CD14/TLR4-dependent inflammation signal pathway.
22999728 CD14++CD16+ monocytes independently predicted cardiovascular events in subjects referred for elective coronary angiography.
22961048 A pro-inflammatory CCL2-producing CD14+CD16+ monocyte subset expands selectively in HIV-1 infection and could potentially participate in causing immunopathology.
22937756 Four single nucleotide polymorphisms within the promoter of the CD14 gene are associated with susceptibility to pulmonary tuberculosis in Han Chinese subjects.
22812245 The interaction between the high-carbohydrate/low-fat diet and the C allele at CD14 -159 can decrease LDL-c/HDL-c in both males and females and increase TG/ HDL-c and log (TG/HDL-c) in females.
22808111 CD14 is significantly downregulated from the surface of HIV-1 Nef-expressing THP-1 monocytes compared to that from the surface of control cells
22737215 TLR2 augmentation on CD14+ monocytes might be an inflammatory marker for both human Kawasaki disease patients and LCWE-induced coronary arteritis mouse model
22703766 soluble CD14 does not appear to be a solely prominent element of innate immunity in multiple sclerosis
22697010 No differences were observed between atopic patients with high/low tuberculosis scores and CD14 genotypes.
22648004 The c.-1145A>G G and c.-159C>T T alleles (as well as the combination of the two alleles in the GT haplotype), were identified as susceptibility factors for celiac disease development.
22605977 This genetic study provides evidence that the three major CARD15/NOD2 variant alleles and the CD14 -159C/T polymorphism are associated with Crohn's disease (CD) susceptibility in the Saudi population.
22564189 epigenetic regulation of CD14 in placenta might be involved in the protective effect of 'living on a farm', with regard to allergy development.
22482418 Data show that proportions of CD14(+) PD-L1(+) monocyte were correlated with disease activity and production of antibody.
22445606 sCD14 increased cytokine production by human dendritic cells (DCs) and sCD14-primed DCs augmented human CD4T cell proliferation
22384567 No relationship between rs2569192, rs3138078 polymorphisms and allergic rhinitis was found in Xinjiang Uygurs and Hans.
22376040 In Korean asthmatic children, increased serum IgE level was a multi-locus interaction between IL-4Ralpha, IL-13, IL-13Ralpha1, CD14, and CTLA4 polymorphisms. The combination of CTLA4/IL-13 and IL-13/IL-13Ralpha1 polymorphisms showed strong synergistic effects.
22363790 Soluble CD14 correlates with the severity of liver disease and predicts early response to peg-INF-alpha/ribavirin.
22265692 FSTL1 induced interleukin 6 or interleukin 8 production from target cells in a CD14- and TLR4-dependent manner.
22260507 human CD14 acts only as co-receptor to human TLR9, but not TLR3, TLR7 or TLR8
22232682 CD14 is required as a co-receptor, with complement recpetor 3, to mediate the phagocytosis of Borrelia burgdorferi.
22219617 The promoter polymorphism at -159 C/T of the CD14 gene is positively associated with IBD, both ulcerative colitis and Crohn's disease.
22056216 In patients with stable coronary artery disease the CRP 1444TT and CD14 260TT variants are associated with larger coronary plaque volume independently of concomitant cardiovascular risk factors.
22015088 study found SNP -159C/T not associated with asthma in Slovenian children; however, non-atopic asthmatics with CT or TT genotypes have lower FEV1/FVC ratio, a measure of bronchial obstruction; they also have increased bronchial hyperreactivity
22014346 CD14-positive monocyte-derived progenitor cells are associated with cardiac allograft vasculopathy.
21948372 Lipopolysaccharide cytokine response was efficiently and equally abolished by MD-2 and CD14 neutralization; the response induced by whole E. coli bacteria was only modestly reduced by MD-2 neutralization, whereas CD14 neutralization was more efficient.
21921097 Data show that circulating levels of sCD14 are increased in rheumatoid arthritis, are highest in patients with increased levels of disease activity, and appear to be influenced by age and race but not by genetic variation in CD14.
21905503 genetic polymorphism is associated with atopy in Pakistani adults
21885391 There was no evidence that mattress endotoxin level was associated with respiratory symptoms or IgE sensitisation but the association of lung function with endotoxin levels may be modified by CD14 genotype.
21842127 The frequencies of C and T allele in Antigen CD14 were 36.2 and 63.8%, respectively, in the asthma group.
21808991 Data suggest that umbilical cord blood-derived endothelial progenitor cells are confined to CD14-/CD34+ subpopulation and angiogenin1 released from CD14+ subpopulation may be an important factor promoting the EPC colony formation.
21799175 Demonstrate a major impact of fat mass variations on CD14(dim)CD16(+) monocyte subsets and that the decrease in the CD14(+)CD16(+) subpopulation is linked to a reduction of subclinical atherosclerosis.
21745379 A protective dose-response relationship between the CD14 -260T allele and atopic asthma susceptibility was observed
21740312 The availability of commercial methods for the automated measurement of the soluble CD14 subtype presepsin and lipopolysaccharide binding protein represent a challenge for the evaluation in clinical practice of reliable markers of neonatal sepsis.
21722015 Aseptic trauma primes the innate immune system for the posttraumatic release of lipopolysaccharide binding protein and sCD14
21705839 downregulated in human glioblastoma cell line U87 MG
21700881 CD14 modulates adipose tissue inflammatory activity and insulin resistance.
21633598 This study highlights the LBP rs2232596 and CD14 rs4914 polymorphisms as biomarkers for elevated colorectal carcinoma susceptibility in the Chinese Han population
21596674 This study suggests that CD14 levels increase in response to bacterial diarrhea and that polymorphisms in the CD14 gene influence susceptibility to traveler's diarrhea.
21498585 These results highlight a fundamental difference between toll-like receptor agonists in their requirements for CD14 and serum components.
21489615 Single nucleotide polymorphisms of CD14, IL-13 and IL-4 receptor are associated with hexamethylene diisocyanate asthma.
21476947 CD14-260C/T polymorphism can contribute to B-ALL (Precursor B-Cell Lymphoblastic Leukemia-Lymphoma) risk in a Chinese population.
21389010 The association between occupational endotoxin exposure and wheeze in agricultural workers was significantly modified by genetic variants in CD14 and MD2
21361908 Findings indicate that MCP-1 can expand CD14(+) CD16(+) monocytes in patients with breast cancer.
21333644 C(-260)T polymorphism in the promoter of CD 14 gene is not associated with myocardial infarction.
21303362 Data indicate that individuals with high percentage of CD14(+) CD16(+) demonstrated significantly lower (P<0.05) plasma levels on the IL-10.
21293259 the most specific for detection of aberrant monocytic cells in the diagnoses of monocytic leukemias
21278688 CD14 promoter gene C-159T polymorphism does not seem to be associated with nutritional status parameters in hemodialysis patients.
21277522 C allele of rs2569190 of CD14 may be an important risk factor for the development of peanut allergy.
21257965 Two distinct subsets of CD14-positive macrophages present in first-trimester decidual tissue have distinct transcriptional profiles: CD11c(HI) and CD11c(LO).
21253969 TLR4, CD14, and NF-kappaBp65 were upregulated significantly in UC, to an extent that reflects the degree of inflammation and thereby might contribute to the occurrence and development of ulcerative colitis.
21209279 Mycobacterium tuberculosis H37Rv growth rate is 5.6-fold more rapid in CD14hi monocyte-derived macrophage (MDM) subsets from healthy donors compared to the microbial growth rate in CD14loCD16-positive MDMs.
21191073 Patients with chronic inflammatory diseases and elderly subjects show an increased percentage of monocytes with low expression of CD14.
21178007 HEK cells stably transfected with TLR2 secrete significantly higher amounts of interleukin (IL)-8, with Panton-Valentine leukocidin-mediated synthesis being enhanced in the presence of CD14.
21172039 The significant increase in plasma endotoxin and soluble CD14 levels during biliary atresia implies a possible involvement of endotoxin stimulated CD14 production.
21118416 Homozygocity for the C allele of the CD14 (C260T) polymorphism (CC) was associated with a two--fold increased susceptibility to periodontitis. The CC genotype of CD14 (C260T) is related to susceptibility to chronic periodontitis in Caucasians.
21084593 Transgenic CD14 is a critical regulator of the microglial inflammatory response that acts to modulate amyloid beta protein. deposition.
21079949 This meta-analysis suggests that CD14 is a candidate gene for atopic asthma susceptibility. The -159C/T polymorphism may be a protective factor for atopic asthma in Asian and children. (Review)
21079949 Meta-analysis of gene-disease association. (HuGE Navigator)
21063024 Data show that CD14(+)HLA-DR(low/-) monocytes are a major and multifactorial contributor to systemic immunosuppression in NHL.
21062235 CD14 expression in adenoids and tonsils illustrates an important immunological sentinel function of the innate immunity of the upper airway.
21052690 Observational study of gene-disease association. (HuGE Navigator)
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
21041645 Infection of primary human CD14+ monocytes with a clinical strain of human cytomegalovirus exhibits the hallmarks of latency.
21039068 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20964518 Expression of CD14 and CD326 can be used to identify functionally distinct subsets of fetal liver cells.
20876990 The increased levels of sCD14 can be considered as a marker of inflammation and innate immune response during Early childhood caries.
20865702 Low CD14 is associated with Crohn's disease.
20832340 CD14(dim) cells are bona fide monocytes involved in the innate local surveillance of tissues and the pathogenesis of autoimmune diseases.
20826579 Significan reduction in expression of CD14 in human adrernal cortex tumors.
20730440 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20723409 CD14C-159T gene polymorphism might markedly influence the synthesis and release of HMGB1, and it is associated with increased susceptibility of sepsis in patients with severe burns.
20723409 Observational study of gene-disease association. (HuGE Navigator)
20717070 Data show that alpha-lactalbumin and CD14 form a complex in the gut which alters degradation of CD14, suggesting a mechanism by which this key LPS receptor may remain functional in the neonatal gut.
20703737 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20660791 Monocytes help in the survival of chronic lymphocytic leukemia cells by secreting soluble CD14.
20636398 Data indicate that the CD14(+) CD16(+) monocytes from CCA patients with pro-tumorigenic characteristics may associate with rapid tumour progression and poor patient outcome.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20618347 CD14 genotype may contribute to cockroach allergy susceptibility.
20608916 PBMC from asthmatic children with the TT genotype at position -159 of the CD14 gene make more IgE than those with the CC genotype following LPS stimulation because of increased germline transcription and have an augmented Th2 cytokine profile.
20608916 Observational study of gene-disease association. (HuGE Navigator)
20603037 Observational study of gene-disease association. (HuGE Navigator)
20587312 CD14 and TLR4 mRNA are upregulated during in severe hepatitis B induced by endotoxin.
20579716 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20555320 In ADPKD, baseline urinary CD14 level showed some tendency to correlate with the 2-year change in total kidney volume; the association was significant when the analysis was confined to males
20536507 Observational study of gene-disease association. (HuGE Navigator)
20536280 Observational study of gene-disease association. (HuGE Navigator)
20532808 IL-33, acting specifically through ST2, regulates the formation of osteoclasts from human peripheral blood CD14+ monocytes and bone resorption.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20485444 Observational study of gene-disease association. (HuGE Navigator)
20472613 genetic polymorphism is not associated with sudden infant death syndrome in a large South Australian cohort
20472613 Observational study of gene-disease association. (HuGE Navigator)
20472010 Data show that blocking TLR2, TLR4 or CD14 resulted in a approximately 60%-70% decrease in mmLDL-induced TNF-alpha secretion.
20463618 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20430725 Data show that CD180, CD284 and CD14 expression is higher on normal B cells than on CD19+ B-cell chronic lymphocytic leukaemia cells.
20430603 Results suggest a role of CD14 in the pathogenesis of sarcoidosis, and a clinical phenotype-genotype association.
20430603 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20398919 The reduced effect of CD14 polymorphisms on sCD14 levels from early to late childhood paralleled a small but significant increase in CD14 methylation during the same period
20398919 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20394509 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20384875 Allergen challenge leads to a significant increase in sCD14 concentrations in bronchoalveolar lavage fluid and might modulate the allergen-induced inflammation
20381257 Observational study of gene-disease association. (HuGE Navigator)
20377740 sMD-2 and sCD14 inhibit the growth of both Gram-positive and Gram-negative bacteria.
20364047 differences in monocyte CD14CD16 expansion represent an important tool for exploring the role of selective inflammatory pathways in heart failure progression
20363151 Observational study of genotype prevalence. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20302606 This study demonstrates for the first time the expression, regulation and clinical significance of soluble and membrane CD14 receptors in pediatric inflammatory lung diseases and suggests sCD14 as potential marker for pneumonia in children.
20227257 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20219985 GPx-1 modulates LPS-mediated up-regulation of ICAM-1 and VCAM-1 mRNA and protein in endothelial cells, in part, by altering CD14-mediated effects.
20207250 Observational study of gene-disease association. (HuGE Navigator)
20179016 In glioblastoma patients, the major population of altered CD14-positiveHLA-DRlo/negative monocytes have a phenotype distinct from classical myeloid suppressor cells.
20163933 Observational study of gene-disease association. (HuGE Navigator)
20113368 (i) FSL-1 is internalized into macrophages via a clathrin-dependent endocytic pathway, (ii) the FSL-1 uptake by macrophages occurs irrespective of the presence of TLR2, and (iii) CD14 and CD36 are responsible for the internalization of FSL-1.
20109750 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20109306 promoter gene polymorphism is associated with allergic rhinitis in Chinese adults
20109306 Observational study of gene-disease association. (HuGE Navigator)
20092898 The CD14-dependent meconium-induced inflammatory reaction is mediated through the TLR4/MD2 complex.
20085599 Observational study of gene-disease association. (HuGE Navigator)
20039305 the lipid A mimetic CRX-527 does not require the CD14 co-receptor to elicit TLR4-mediated responses
19997857 651C/T promoter polymorphism in the CD14 gene was associated with severity of acute pancreatitis in Japan
19997857 Observational study of gene-disease association. (HuGE Navigator)
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19928913 Direct binding to CD14 by the synthetic TLR4 antagonist mediated principally through the lipid chains of the synthetic compound.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19892918 Observational study of gene-disease association. (HuGE Navigator)
19860589 genetic polymorphism influences survival in critically ill patients
19860589 Observational study of gene-disease association. (HuGE Navigator)
19847953 The frequencies of CD14-260 TT and T carrier were significantly lower in patents with intestinal type gastric cancer than in controls.
19845895 Observational study of gene-disease association. (HuGE Navigator)
19830784 Association between the C genotypes of CD14 (-260) variant and prostate cancer. This supports hypothesis that genetic variation in inflammatory process can contribute to prostate cancer susceptibility in African American men.
19830784 Observational study of gene-disease association. (HuGE Navigator)
19829130 Genetic polymorphisms in the promoter region of the CD14-receptor gene are associated with a higher risk of having an acute coronary syndrome as first the manifestation of coronary artery disease.
19829130 Observational study of gene-disease association. (HuGE Navigator)
19824106 LPS/CD14/TLR4-mediated inflammation has a role in necrotizing enterocolitis in humans and rats
19809507 CD14 C-159T and toll-like receptor 4 Asp299Gly polymorphisms have roles in surviving meningococcal disease
19809507 Observational study of gene-disease association. (HuGE Navigator)
19799036 Expression of CD14 in patients with TT, TC genotype is much higher than those in burn patients with CC homozygote.
19795323 CD14 promoter polymorphism (- 159C-->t) is not associated with myocardial infarction or coronary artery disease in patients with assumed high genetic risk.
19761511 We found only a protective association between CD14 gene (SNP CD14/-1619) and infant eczema at the age of 2 yrs.
19761511 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19758335 In conclusion, the -159TT CD14 genotypes were associated with tuberculosis development in Koreans.
19758335 Observational study of gene-disease association. (HuGE Navigator)
19741468 TLR4/CD14 and TLR3 polymorphisms have roles in acute rejection after kidney transplantation
19741468 Observational study of gene-disease association. (HuGE Navigator)
19733948 sCD14 and il-6 levels are associated with inflammation and protein-energy wasting in hemodialysis patients.
19729601 Observational study of gene-disease association. (HuGE Navigator)
19701968 Data suggest a possible relationship between CD14 C-159T polymorphism and the formation of portal lymphoid aggregates, but not liver fibrosis progression in chronic hepatitis C.
19701968 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19674346 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19605672 CD14 gene promoter C-159T polymorphism is significantly correlated with juvenile idiopathic arthritis in the Chinese Han population.
19605672 Observational study of gene-disease association. (HuGE Navigator)
19595045 CD14-159C/T polymorphism could influence the T cell-mediated immunity in extensively burned patients.
19595045 Observational study of gene-disease association. (HuGE Navigator)
19584052 high affinity interactions between the palmitoyl-oleoyl-phosphatidylglycerol and the Toll-like receptor 4-interacting proteins CD14 and MD-2.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19572148 Findings suggest the important role of the CD11b+/CD14/CD15+/CD33+ MDSCs in mediating immunosuppression in NSCLC.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19550115 The positive rates of both CD11b and CD14 in HL-60 cells were over 90% after 5-day treatment (2 micromol/L ATRA or 10 micromol/L NSC67657.
19536153 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19522765 The growth of C. pneumoniae was highest in CD14 -260 C>T TT genotype cells
19508433 CD14 -159 C>T polymorphism was associated with significantly increased risk for Hodgkin's lymphoma
19508433 Observational study of gene-disease association. (HuGE Navigator)
19500269 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19468702 Data argue for a functional impact of the rs2569190 polymorphism within the CD14 in terms of a stronger transcription initiation on T allele gene variants even if preferential allele-specific binding does not result in an increase in transcript numbers.
19466271 detection of the C159T polymorphism in the CD14 gene revealed a predominance of Cystic Fibrosis patients with the TT genotype (increase in the production of the CD14 protein), although there were no differences in relation to lung disease severity.
19447482 These results suggest that day care attendance is associated with serum IgE levels, and this effect is modified by CD14-550C/T and IL4R Ile50Val polymorphisms.
19433913 the CD14 C260T polymorphism is not a risk factor for cerebrovascular diseases.
19433913 Meta-analysis of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19420105 Observational study of gene-disease association. (HuGE Navigator)
19390489 Results reveal the contribution of TLR4 and CD14 in neonatal cytokine and chemokine release and could aid in design of antagonists to prevent harmful inflammation.
19365146 These findings suggest that ouabain downregulates mCD14 expression on monocytes through EGFR transactivation and p38 MAPK activation.
19361972 CD14 may be a factor in the pathophysiology of chronic obstructive pulmonary disease, as it is in asthma and smoking-related cardiovascular diseases.
19361972 Observational study of gene-disease association. (HuGE Navigator)
19360901 These results suggest that microglia-derived soluble CD14 is a candidate CSF biomarker for Alzheimer's and Parkinson's disease, and the soluble CD14 may inhibit glial activation by interfering with lipopolysaccharide effects
19346955 Meta-analysis of gene-disease association. (HuGE Navigator)
19337058 The CD14-159C/T and the TLR9-1237T/C promoter polymorphisms increase the risk of precancerous outcomes, but they do not seem to increase the risk of gastric cancer itself.
19337058 Observational study of gene-disease association. (HuGE Navigator)
19318422 increased plasma levels of sCD14 in periodontits patients
19275920 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19264973 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254290 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19242719 bone marrow biopsy immunohistochemistry can be helpful in chronic myelomonocytic leukemia by identifying both the monocyte expansion with CD14 and the dysgranulopoiesis with CD16.
19225544 Observational study of gene-disease association. (HuGE Navigator)
19222419 An Eastern vs Western environment appears to exert an effect via opposite alleles of CD14 and CC16 genes on risk of allergic diseases in adult women.
19222419 Observational study of gene-disease association. (HuGE Navigator)
19210273 Observational study of gene-disease association. (HuGE Navigator)
19200604 Observational study of gene-disease association. (HuGE Navigator)
19189651 Carriers of the CD14 gene -159T allele had a marginally increased risk of developing gastric MALT lymphoma than the controls.
19189651 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19148143 Observational study of gene-disease association. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19096003 Single nucleotide polymorphisms in CD 14/-260 allele were found to be negatively associated with increased risk for asthma and not to be associated with atopy in country living in French study.
19096003 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19060757 Observational study of gene-disease association. (HuGE Navigator)
19046305 there is no evidence that CD14 and TLR4 polymorphisms investigated are independent risk factors for chronic or aggressive periodontitis in German periodontitis patients.
19046305 Observational study of gene-disease association. (HuGE Navigator)
19037967 There was an interaction between the CD14-159 allele T carrier status and H. pylori antibodies on serum total IgE (P=0.004).
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19027777 Upregulated ex vivo expression of stress-responsive inflammatory pathway genes by LPS-challenged CD14(+) monocytes in frail older adults.
19019335 Observational study of gene-disease association. (HuGE Navigator)
19010986 Lipopolysaccharide-binding protein and CD14 are increased in the bronchoalveolar lavage fluid of smokers
19006850 Our results demonstrate that the +896A/G TLR4 single nucleotide polymorphism (SNP) is associated with Alzheimer disease, whereas no association has been observed with -260C/T CD14 SNP
19006850 Observational study of gene-disease association. (HuGE Navigator)
18991094 single nucleotide polymorphism in the promoter region influences protein expression and confers susceptibility to sepsis
18991094 Observational study of gene-disease association. (HuGE Navigator)
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18974842 Observational study of gene-disease association. (HuGE Navigator)
18974840 Observational study of gene-disease association. (HuGE Navigator)
18951711 CD14-159 C/T polymorphism might be associated with the kinetics and extent of CD14 expression as well as its release, and it was also related to TNF-alpha expression
18951711 Observational study of gene-disease association. (HuGE Navigator)
18938271 Results suggest that the elevated salivary CD14 concentration may be one of the host-response components associated with the clinical manifestations of periodontal disease.
18931892 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18794053 CD14 genotype may modulate the risk of stroke by influencing individual susceptibility and immune response to C pneumoniae infection
18794053 Observational study of gene-disease association. (HuGE Navigator)
18774388 Observational study of gene-disease association. (HuGE Navigator)
18767926 the CD33+ CD14- phenotype is characteristic of multinuclear osteoclast-like cells in giant cell tumor of bone
18728522 In patients with type 1 diabetes mellitus, the CD14 C-260TT homozygous genotype increases the risk for the development of celiac disease.
18728522 Observational study of gene-disease association. (HuGE Navigator)
18714537 the C allele of CD14 & the 4G allele of SERPINE1 were encountered more in house dust mite-allergic asthmatic patients than controls; results indicate PAl-1 & CD14 may interact to affect susceptibility to allergic asthma
18714537 Observational study of gene-disease association. (HuGE Navigator)
18691306 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18666712 These findings indicated that the polymorphisms of CD14, but not TLR4 Asp299Gly and Thr399Ile mutations, may be an important genetic factor for HBV-related cirrhotic injury in the Chinese Han population.
18666712 Observational study of gene-disease association. (HuGE Navigator)
18664531 Exercise training-induced reductions in CD14+CD16+ monocytes may contribute to the anti-inflammatory effects of exercise training.
18634146 The CD14-260bp T promoter variant in CD14 showed an association with Ankylosing Spondylitis in the Finns only, not patients from the United Kingdom
18634146 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18606699 endothelial mCD14 plays essential role that cannot be replaced by sCD14; Furthermore, we have provided evidence for a TRAM pathway in endothelium that is dependent on mCD14 even when other responses are no longer mCD14 dependent.
18596635 Observational study of gene-disease association. (HuGE Navigator)
18580477 Patients with graft verus host disease showed increased CD86+Cd14+ cells in peripheral blood and bone marrow cells.
18580445 CD14 polymorphisms studied seem not to play a role in determining the severity of alcoholic pancreatitis or the risk of developing alcoholic pancreatitis.
18580445 Observational study of gene-disease association. (HuGE Navigator)
18571004 Observational study of gene-disease association. (HuGE Navigator)
18565258 The CD14 gene is very unlikely to be genetically involved in the pathogenesis of Japanese rheumatoid arthritis
18565258 Observational study of gene-disease association. (HuGE Navigator)
18519568 the monomeric form of sMD-2 is the active species both for reaction with endotoxin.secreted CD14 and Toll-like receptor 4 (TLR4), as needed for potent endotoxin-induced TLR4 activation
18497880 intestinal macrophages expressing CD14 contribute to the pathogenesis of Crohn disease via IL-23/IFN-gamma axis
18496988 It is difficult to establish a role for CD14 in the disease pathogenesis of Dutch sarcoidosis patients.
18495781 Myeloid zinc factor-1 is involved in a calcitriol-induced signaling pathway leading to myeloid cell differentiation and activation of CD11b and CD14.
18458151 These results suggest that LTA signaling preferentially occurs at the plasma membrane, is independent of internalization, and is facilitated by CD36 and CD14 as coreceptors for TLR2.
18426570 This study is the first to show higher levels of plasma sCD14 and monocyte mCD14 expression in young, clinically healthy PiZZ AAT subjects.
18425216 Observational study of gene-disease association. (HuGE Navigator)
18417506 In CD14, the rs2569190-TT and rs2569191-CC genotypes associated with lower IgE and decreased risk of sensitisation at 4 and 8 yrs in children exposed to pets, with an opposite effect in nonexposed children
18417506 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18415752 Observational study of gene-disease association. (HuGE Navigator)
18414664 Increased sialoadhesin expression on CD14(+) monocytes occurs in response to HIV-1 infection with maximum expression associated with high viral load
18385826 Observational study of gene-disease association. (HuGE Navigator)
18354240 Gene expression analysis of the endothelial-like colonies formed by CD14(+) cells showed that colony formation is a proangiogenic differentiation and might reflect the ability of monocytes to facilitate vascularization
18320914 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18315435 expression in chronic periodontitis lesions is [not] associated with a distinct genotype
18315435 Observational study of gene-disease association. (HuGE Navigator)
18312481 it was concluded that TLR9 and CD14 gene polymorphisms may contribute to an inherited predisposition to asthma in Tunisian children.
18312481 Observational study of gene-disease association. (HuGE Navigator)
18288274 Lipopolysaccharide binding protein and sCD14 are not produced as acute phase proteins in cardiac surgery
18182917 Observational study of gene-disease association. (HuGE Navigator)
18180796 Observational study of gene-disease association. (HuGE Navigator)
18180316 study has demonstrated a robust augmentation by high glucose of lipopolysaccharide (LPS)-stimulated CD14 antigen expression through activator protein-1 (AP-1) and nuclear factor kappaB (NFkappaB)
18174680 Inflammatory bowel disease appears to be associated with the CD14 c.1-260C>T promoter variant in Germans and Hungarians.
18174680 Observational study of gene-disease association. (HuGE Navigator)
18158110 Observational study of gene-disease association. (HuGE Navigator)
18157711 Observational study of gene-disease association. (HuGE Navigator)
18067042 Observational study of gene-disease association. (HuGE Navigator)
18067042 159T allele associated with decreased glomerular filtration rate
18057002 structural analysis of CD14 and discussion of the role of disulfide bonds and N-linked glycosylation
18056918 Chlamydiaceae LPS has low binding affinities for LPS recognition molecules such as CD14 and LBP and exhibit weak biological activities against host immune cells including monocytes.
18040078 Dysregulation of TLR2, TLR4, and CD14 expression in different parts of the intestinal mucosa may be crucial in IBD pathogenesis.
18008256 Observational study of gene-disease association. (HuGE Navigator)
18008256 in the present study, the susceptibility to develop tuberculosis was found to be associated with CD14 -159TT but not with an increase in the expression of CD14
17982638 Antioxidants induce a slight increase of differentiated cells and a significant increase of CD14 mRNA in an Acute Promyelocytic Leukemia cell line.
17949800 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17943182 The epigenetic control of gene transcription by histone acetylation is important for 1,25D3-regulated cathelicidin and CD14 expression.
17934216 Transfer of endotoxin from MD-2 to extracellular soluble CD14 reduces activation of cells expressing TLR4 without MD-2.
17925604 CD14 is differently expressed in monocytes in subgroups of acute coronary syndromes
17919709 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17919709 A polymorphism in the CD14 gene (CD14/-1721) modifies the inverse association of early farm milk consumption on allergic diseases in children in 2 independent rural populations, independent of being a farm child.
17916440 the levels of sCD14 and sTLR-2 in saliva were upregulated in oral lichen planus and burning mouth syndrome. Oral epithelial cells in the saliva of patients exhibited elevated levels of CD14 mRNA and decreased levels of TLR-2 mRNA.
17913858 Observational study of gene-disease association. (HuGE Navigator)
17913858 High prevalence of the CD14-159CC genotype in patients infected with SARS is reported.
17900622 Subjects carrying both the CD14 (-260) C/C and the LXRbeta (intron 5) G/G genotypes had a six times lower risk of developing AD than subjects without these risk genotypes. These data support a role for innate immune response genes in risk for AD.
17900622 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17877801 Observational study of gene-disease association. (HuGE Navigator)
17877764 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17877764 The CD14/-260 and CD14/-651 promoter polymorphisms are associated with atopic hypersensitivity prevalence among young adults exposed to farm environments.
17869646 Plays a role in mediating monocytic scavenger functions.
17846597 common allelic variants in promoter regions of genes encoding for molecules involved in either the innate (CD14) or adoptive (CTLA-4) immune reactions are associated with an increased risk of GVHD after allogeneic stem cell transplantation.
17802898 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17653770 functional promoter polymorphism, -260 C > T, of CD14 that is a main receptor of bacterial lipopolysaccharide. the frequencies of CD14 TT genotype was higher in Buerger disease.
17653770 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17617027 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17617027 There was no association between IL-10 and CD14 polymorphisms and myocardial infarction occurrence
17600225 In unstable angina patients oxidized LDL may contribute to upregulating CD14 expression in monocytes
17565650 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17565650 The existence of a mutation in the CD14 gene is associated with an increased susceptibility to ulcerative colitis.
17515856 Observational study of gene-disease association. (HuGE Navigator)
17515856 CD14 polymorphism (-159 cytosine/thymine) might partly explain the difference in predisposition to develop complications of infectious diseases in different patients.
17511783 Observational study of gene-disease association. (HuGE Navigator)
17511783 nancy will fill
17471431 CD14 -550 C/T, which is related to the serum level of sCD14, is associated with the development of respiratory syncytial virus bronchiolitis in the Japanese population.
17456337 CD14/-159 SNP is associated with atopic diseases in Chinese Han ethnic group children.
17456337 Observational study of gene-disease association. (HuGE Navigator)
17448042 Observational study of gene-disease association. (HuGE Navigator)
17448042 an evident association exists between the carriage of the T-containing genotype and and the extent periodontal disease
17438094 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17438094 Functional polymorphism in CD14 is associated with greater risk of H. pylori-related gastric carcinoma, which might be mediated by elevated CD14.
17436151 Observational study of gene-disease association. (HuGE Navigator)
17436151 Reports of progression of atherosclerosis in CD14 gene polymorphism in different populations are conflicting. Screening for CD14 159C/T polymorphism is unlikely to be a useful tool for risk assessment of MI at young age.
17309585 Observational study of gene-disease association. (HuGE Navigator)
17309585 Promoter polymorphisms of the CD14 gene did not influence susceptibility to inflammatory periodontitis in the population cohorts studied.
17304102 Observational study of gene-disease association. (HuGE Navigator)
17304102 reduced signaling through CD14/toll-like receptor 4 in response to challenge by gram-negative bacteria after burns results in a blunted innate immune response and subsequent increased likelihood for systemic infection and death
17274987 CD14 is a novel ligand for alpha4beta1, exhibiting similar activation-state dependent binding characteristics as other alpha4beta1 ligands.
17264400 Observational study of gene-disease association. (HuGE Navigator)
17259806 Observational study of gene-disease association. (HuGE Navigator)
17259806 CD14-159 and -550 polymorphisms might not play a major role in the pathogenesis of food allergy in Japanese children
17217435 We considered the effects of a common promotor polymorphism of the lipopolysaccharide receptor CD14 associated with increased transcriptional activity upon the development of posttransplant rejection and graft survival.
17207357 Observational study of gene-disease association. (HuGE Navigator)
17205552 Signaling by soluble CD14 was TLR2 dependent. CD14-triggered TLR2-mediated response in astrocytes lead to the production of CXCL8, IL-6, and IL12p40, whereas typical TLR-induced pro-inflammatory cytokines were not produced at detectable levels.
17201240 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17196641 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17187267 Observational study of gene-disease association. (HuGE Navigator)
17187267 CD14-C159T polymorphism is not associated with familial Mediterranean fever or development of amyloidosis in the population studied
17126402 PI3 kinase effectors PKB and PKC(zeta) are also activated by PI3 kinase in a CD14 dependent manner in lipopolysaccharides stimulated human peripheral blood mononuclear cells.
17098305 Observational study of gene-disease association. (HuGE Navigator)
17098305 pathogenetic role of the CD14 C-260T polymorphism in atherosclerosis as -260TT genotype may favour increased inflammation in atheroma promoting possible worsening atherosclerosis
17087609 further evidence is provided for the role of CD14 C(-260)--> T promoter polymorphism as a genetic susceptibility marker of atherosclerosis
17087609 Observational study of gene-disease association. (HuGE Navigator)
17086894 Observational study of gene-disease association. (HuGE Navigator)
17086894 no association of CD14 or TLR4 polymorphisms with H. pylori-related gastric malignancy.
17075287 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17067484 Observational study of gene-disease association. (HuGE Navigator)
17062130 Observational study of gene-disease association. (HuGE Navigator)
17056323 Observational study of gene-disease association. (HuGE Navigator)
17052752 A marker that may be used used to detect macrophages and in the anatomical plane of the fetomaternal junction.
17046070 serum sCD14 levels are increased in MS and correlate inversely with disease activity in relapsing multiple sclerosis patients
17030237 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17007028 Observational study of gene-disease association. (HuGE Navigator)
17007028 These findings show the role of a single-nucleotide polymorphism at CD14/-159 on the development of chronic hepatitis B. Endotoxin susceptibility may play a role in the pathogenesis of chronic hepatitis B.
17003960 Observational study of gene-disease association. (HuGE Navigator)
17003960 CD14 plays a role in IgE-mediated allergic diseases, and its gene polymorphisms can be important for manifestation of these disorders
16950521 Observational study of gene-disease association. (HuGE Navigator)
16950521 CD14/-159 polymorphism may play a role in the development of perennial allergic rhinitis in Korean children.
16950285 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16933467 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16933467 A mutation in CD14 is associated with sarcoidosis.
16916546 Observational study of gene-disease association. (HuGE Navigator)
16893989 Observational study of gene-disease association. (HuGE Navigator)
16890863 Observational study of gene-disease association. (HuGE Navigator)
16879054 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16873708 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16860318 description of a novel feedback mechanism in apoptotic signaling pathway for SGLT-1-dependent cytoprotection; observation suggests new function for CD14 on enterocytes involving induction of caspase-dependent SGLT-1 activity which leads to cell rescue
16848791 This study suggests that CD14 directly binds to triacylated lipopeptides and facilitates recognition of the lipopeptides by the TLR2/TLR1 complex without binding to the receptor complex.
16836908 This study revealed a significant increase in the expression of CD14 and TLR4 in inflamed human dental pulp tissue.
16815140 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16785528 New insights are provided into the importance of stoichiometry among the components of the TLR4/MD-2/CD14 complex; supraoptimal CD14 levels do not suppress lipopolysaccharide-induced signaling.
16751411 Pathogen recognition receptor CD14 is involved in activation of immature monocyte-derived dendritic cells by the envelope protein surface unit (ENV-SU) of multiple sclerosis-associated retroviral element (MSRV) of human endogenous retrovirus.
16749413 Observational study of gene-disease association. (HuGE Navigator)
16706818 Observational study of gene-disease association. (HuGE Navigator)
16706818 findings indicated that the polymorphism of CD14 but not TLR4 Asp299Gly mutation was associated with Chinese patients with colorectal cancer, and the CD14 gene may contribute to the predisposition to colorectal cancer
16698680 Observational study of gene-disease association. (HuGE Navigator)
16625214 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16625214 Multifactor dimensionality reduction (MDR) test was applied to detect epistasis, and identified single-IL4R(Q576R)- and three-IL4R(Q576R), IL5RA(-80), CD14(-260)- locus association models that predict multiple sclerosis risk with 75-76% accuracy.
16614348 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16611358 Observational study of gene-disease association. (HuGE Navigator)
16611358 The IL-6 -174 G/C, IL-10 -1082 G/A and CD14 -260 C/T SNPs may alter risk for sepsis in ventilated VLBW infants
16552356 Ciprofloaxin suppressed the expression of CD14 induced by lipopolysaccharides in monocytes.
16538169 Observational study of gene-disease association. (HuGE Navigator)
16520888 Observational study of gene-disease association. (HuGE Navigator)
16512634 Significantly elevated serum concentrations of LBP and sCD14 are found in severe sepsis patients.
16509825 Observational study of gene-disease association. (HuGE Navigator)
16492974 Results suggest that the presence of intact breast milk soluble CD14 in the upper digestive system could promote innate immunity in this low bacteria density lumen.
16467036 Observational study of gene-disease association. (HuGE Navigator)
16467036 No association between the CD14/C-159T polymorphism and increased risk for the development of rheumatoid arthritis.
16446545 Observational study of gene-disease association. (HuGE Navigator)
16444757 Results identify a new lipopolysaccharide-binding domain of CD14 with a strong lipopolysaccharide-neutralizing activity.
16443672 In conclusion, our results strongly support an important role for endothelial membrane CD14 in the activation of endothelium for leukocyte recruitment.
16437636 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16437636 significant increase of the combined carriership of the CD14 -260T and TLR9 -1237C alleles in the chronic relapsing pouchitis group suggests that these markers identify a subgroup of patients with a risk of developing chronic or refractory pouchitis
16433727 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16427140 Observational study of gene-disease association. (HuGE Navigator)
16409569 Observational study of gene-disease association. (HuGE Navigator)
16387800 Observational study of gene-disease association. (HuGE Navigator)
16387800 Subjects with CD14 -159CC were more likely to have moderate or severe acute asthma.
16386288 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16385250 Observational study of gene-disease association. (HuGE Navigator)
16368002 Observational study of gene-disease association. (HuGE Navigator)
16368002 The role of the CD14 -260 C>T polymorphism in the susceptibility to and severity (defined as subfertility and/or tubal pathology) of C. trachomatis infection in women is reported.
16337421 Observational study of gene-disease association. (HuGE Navigator)
16331574 The T allele of the C-159T polymorphism of CD14 gene may be a risk factor for myocardial infarction.
16331574 Observational study of gene-disease association. (HuGE Navigator)
16292464 Observational study of gene-disease association. (HuGE Navigator)
16290232 Maternal allergy status may affect allergic risk in offspring through a decreased expression of fetal CD14.
16283111 In patients with community-acquired infection, low on-admission level of monocyte CD14 is related to fatal outcome
16275943 The lipopolysaccharide-binding function characteristic of CD14 enables effective host responses to pathogens.
16273622 Observational study of gene-disease association. (HuGE Navigator)
16273622 The C allele may be associated with the pathogenesis of alcoholic pancreatitis, and alcoholic patients with acute pancreatitis and cirrhosis of liver are probably two different subpopulations.
16273620 Observational study of gene-disease association. (HuGE Navigator)
16273620 C-T (-159) polymorphism in the promoter region of the CD14 gene in patients with alcoholic liver disease and chronic hepatitis C virus infection
16266379 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16266379 CD14-C159T promoter variant influences total IgE levels and also indicates that the T allele has a more profound effect on total IgE in children with atopic asthma
16246938 Observational study of gene-disease association. (HuGE Navigator)
16239565 CD14 and TLR2 remained upregulated throughout the experimental period following exposure to Staphylococcus aureus PepG
16194368 Observational study of gene-disease association. (HuGE Navigator)
16174099 Observational study of gene-disease association. (HuGE Navigator)
16174094 The important role of CD14 in innate immunity is reviewed here.
16165702 Observational study of gene-disease association. (HuGE Navigator)
16165702 The genetic determination of the defense mechanisms in Crohn's disease appears to be not associated with the polymorphism of the CD14 genes.
16159630 Observational study of gene-environment interaction. (HuGE Navigator)
16148556 Observational study of gene-disease association. (HuGE Navigator)
16142747 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16142747 Finds that CD14 polymorphisms influence regulators of the inflammation induced by endotoxin in organic dusts
16137548 Observational study of gene-disease association. (HuGE Navigator)
16109674 Observational study of gene-disease association. (HuGE Navigator)
16101942 CT genotype of promotor polymorphism C159T in the CD14 gene is associated with lower prevalence of atopic dermatitis and lower IL-13 production.
16085746 Observational study of gene-disease association. (HuGE Navigator)
16061600 Observational study of gene-disease association. (HuGE Navigator)
16061600 the single-nucleotide polymorphism at CD14/-159 is associated with the development of biliary atresia and idiopathic neonatal cholestasis
16051275 Observational study of gene-disease association. (HuGE Navigator)
16046876 Observational study of gene-disease association. (HuGE Navigator)
16038043 Observational study of gene-disease association. (HuGE Navigator)
16038043 The frequencies of IL-1beta+3 594T, IL-10-1082G and CD14-159T allele were similar in patients with mild or severe pancreatitis and in controls.
15975149 Observational study of gene-disease association. (HuGE Navigator)
15975149 Those with the CD14 -159CC genotype had a significantly increased risk of early infection with P.aeruginosa suggesting that CD14 C-159T plays a role in determining the risk of early infection with P.aeruginosa.
15966209 Observational study of gene-disease association. (HuGE Navigator)
15946916 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15946916 An altered immune response to lipopolysaccharides with influence on the anti-inflammatory therapy seems to play a role in the genetic predisposition to ulcerative colitis for CD14 gene
15940135 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15932345 studies suggest that SP-A could contribute to modulate Re-LPS responses by altering the competence of the LBP-CD14 receptor complex
15879416 Observational study of gene-disease association. (HuGE Navigator)
15867866 Observational study of gene-disease association. (HuGE Navigator)
15854776 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15842262 gene polymorphism is associated with chronic periodontitis in Caucasian subjects of a north European origin
15778383 findings reveal that mycobacteria promote their uptake through a process of "inside-out" signaling involving CD14, TLR2, PI3K, and cytohesin-1. This converts low avidity CR3 into an active receptor leading to increased bacterial internalization
15777548 Observational study of gene-disease association. (HuGE Navigator)
15764151 Observational study of gene-disease association. (HuGE Navigator)
15764151 There was no association found between the CD14-159T allele and Crohns disease or ulcerative coltis nor any interaction with the CARD15 or TNF-alpha alleles.
15753758 Observational study of gene-disease association. (HuGE Navigator)
15753758 CD14 polymorphism associated with increased prevalence of gram-negative bacterial infection in critically ill adults
15741437 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
15714129 There was no significant correlation between CD14-159 promoter polymorphism and the severity of pancreatitis
15686783 Observational study of gene-disease association. (HuGE Navigator)
15670766 These results indicate that the CD14 region spanning amino acids 57-64 is critical for interacting with TLR2 and enhancing TLR2-mediated peptidoglycan signaling.
15655821 Observational study of gene-disease association. (HuGE Navigator)
15655821 co-existence of a mutation in either the TLR4 or CD14 gene, and in NOD2/CARD15 is associated with an increased susceptibility to developing Crohn disease compared to ulcerative colitis
15647432 Observational study of gene-disease association. (HuGE Navigator)
15640605 Observational study of gene-disease association. (HuGE Navigator)
15619435 CD14 is commonly expressed in melamona-infiltrating monocytes/macrophages
15602630 Observational study of gene-disease association. (HuGE Navigator)
15602630 The CD14/-2984 polymorphism but not the CD14/-159 is associated with IgE level in Taiwanese asthmatic children.
15599151 Observational study of gene-disease association. (HuGE Navigator)
15591473 Observational study of gene-disease association. (HuGE Navigator)
15591473 The polymorphism of CD14 gene may play an important role in the development of airway obstruction among adult male farmers.
15558232 The monocytic CD14 expression and serum levels of C-reactive protein, IL-6 and soluble adhesion molecules were higher in the diabetes group than in the group with normal glucose tolerance.
15520404 Observational study of gene-disease association. (HuGE Navigator)
15516360 Observational study of gene-disease association. (HuGE Navigator)
15491315 Observational study of gene-disease association. (HuGE Navigator)
15491315 C -159T promoter polymorphism was associated in female but not in male patients with periodontal disease
15378299 Observational study of gene-disease association. (HuGE Navigator)
15378299 Polymorphism of the CD14 gene is associated with atopic asthma
15373760 Observational study of gene-disease association. (HuGE Navigator)
15373760 Most interestingly, sCD14 levels were regulated differentially by the same genetic variants in plasma and milk
15369724 Observational study of gene-disease association. (HuGE Navigator)
15358661 the presence of the membrane-anchored, but not the soluble, form of CD14 is a strong factor in IL-8 induction in bladder epithelial cells in response to bacterial components
15356557 Observational study of gene-disease association. (HuGE Navigator)
15292769 Observational study of gene-disease association. (HuGE Navigator)
15273551 Observational study of gene-disease association. (HuGE Navigator)
15269840 CD14 and CD16 in monocytes may have a role in development of coronary atherosclerosis and expression of TNF-alpha
15257175 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15257175 Although (C260T) polymorphism in CD14 gene in this study is associated with expression of sCD14, no significant association was found between this polymorphism and early markers of atherosclerosis.
15207785 Observational study of gene-disease association. (HuGE Navigator)
15190267 Observational study of gene-disease association. (HuGE Navigator)
15175649 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15166925 in a study of 2558 unrelated Caucasians, it is concluded that the C159T variant has no important effect on plasma cholesterol levels
15164100 Observational study of gene-disease association. (HuGE Navigator)
15143473 Observational study of gene-disease association. (HuGE Navigator)
15132789 Observational study of gene-disease association. (HuGE Navigator)
15120158 this study provides evidence that Porphyromonas gingivalis outer membrane vesicles contribute to the loss of membrane-bound CD14 receptors from the surface of macrophage-like cells and that gingipains degrade this LPS receptor
15116260 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15116260 concluded that the -159T/C polymorphism in the CD14 monocyte receptor gene was not associated with progression of coronary atherosclerosis in this population nor did it influence the efficacy of pravastatin in the treatment of atherosclerosis.
15081257 Observational study of gene-disease association. (HuGE Navigator)
15081257 Comparison of the genotypes of 242 patients with Guillain-Barre syndrome (GBS) and 210 healthy subjects shows that polymorphisms in CD14 do not confer susceptibility to GBS and are not associated with Campylobacter jejuni infection.
15080833 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15080833 The lack of association between CD14 genotypes and IgE as well as atopic outcomes in this large German study population seems to indicate that CD14 genotypes may not directly be involved in the development of allergies during childhood.
15069085 Involvement of CD14/TLR4, CR3, and phosphatidylinositol 3-kinase in the degradation of IL-1 receptor-associated kinase in response to LPS.
15039096 Observational study of gene-disease association. (HuGE Navigator)
15034063 CD14 can be considered a type 2 acute phase protein (APP) in vivo. Serum levels of CD14 in patients with arthropathies correlates with those of C-reactive protein, an APP, and IL-6, a cytokine known to regulate the synthesis of APP in the liver.
14996480 Observational study of gene-disease association. (HuGE Navigator)
14739370 Observational study of gene-disease association. (HuGE Navigator)
14720421 Observational study of gene-disease association. (HuGE Navigator)
14706103 downregulated by Ehrlichia chaffeensis infection in monocytes
14673018 CD14 and TLR2 but not TLR4 play a major role in lipoteichoic acid -mediated effects on PMN and granulocytes
14672339 Observational study of gene-disease association. (HuGE Navigator)
14672339 CD14 promoter region polymorphism in women with idiopathic recurrent miscarriage
14648231 Observational study of gene-disease association. (HuGE Navigator)
14648231 association between the C(-260)T polymorphism in the CD14 promoter and acute myocardial infarction
14624155 Observational study of gene-disease association. (HuGE Navigator)
14617510 Observational study of gene-disease association. (HuGE Navigator)
14587643 Observational study of gene-disease association. (HuGE Navigator)
14517520 Observational study of gene-disease association. (HuGE Navigator)
14517492 Observational study of gene-disease association. (HuGE Navigator)
14517492 the CD14-159 C --> T polymorphism may be an important genetic trait, related to the ability of CD14 to bind and transport lipids, such as cholesterol
14510720 Observational study of gene-disease association. (HuGE Navigator)
14508193 soluble CD14 is associated with aortic stiffness independently of age, BP and atherosclerosis in humans.
14500479 saliva CD14 promoted the invasion of oral epithelial cells by A. actinomycetemcomitans and consequently augmented the production of IL-8, playing an important role in innate immunity in the oral cavity
12960274 A marker on monocytes that can differentiate into several distinct mesenchymal cell lineages.
12942028 Results show that the surface receptors TLR2/4 and CD14 are essential for in vitro cellular activation induced by Neisseria meningitidis lipopolysaccharide-containing outer membrane vesicles and purified lipopolysaccharides.
12940436 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12938192 increased serum levels in chronic Hepatitis B and C patients and inversely correlated with HBsAg in chronic Hepatitis B
12911501 Observational study of gene-disease association. (HuGE Navigator)
12911501 The polymorphic maeker C-159T of CD14 was associated with serum total IgE concentration in atopic Chinese children.
12897754 Observational study of gene-disease association. (HuGE Navigator)
12897754 The TT genotype of -159 C-->T CD14 is associated with nonatopic asthma and food allergy, particularly in white subjects. Thus CD14 is a candidate gene specifically for nonatopic asthma and not for asthma in general
12885845 Observational study of gene-disease association. (HuGE Navigator)
12853157 results provided experimental evidence for existence of close association between CD14 and HIV coreceptor CXCR4 on human monocytic cells
12832426 there may be a resistive exercise training-induced reduction in TLR4/CD14 expression in older women
12825176 Observational study of gene-disease association. (HuGE Navigator)
12825176 A significant association between the CD14 TT genotype and C. pneumoniae infection was found.
12757265 data suggest that peripheral blood cells are of negligible importance in LPS-induced production of inflammatory mediators in vivo and that LPS may activate genes via a CD14-independent pathway that is slower and less efficient
12756848 Observational study of gene-disease association. (HuGE Navigator)
12754215 data support the hypothesis that lipopolysaccharide binding protein can inhibit cell responses to lipopolysaccharide(LPS) by inhibiting LPS transfer from membrane CD14 to the Toll-like receptor 4-MD-2 signaling receptor
12731067 a new functional role of CD55 as a member of a multimeric LPS receptor complex.
12700637 CD14 is not critical for phosphatidylserine-induced apoptosis in human macrophages
12679473 first study to suggest an effect of a genetic polymorphism of the CD14 gene on both insulin sensitivity (healthy subjects and type 2 diabetic patients) and endothelial dysfunction (sICAM-1 levels) in type 2 diabetes mellitus
12663765 Human cytomegalovirus activates inflammatory cytokine responses via CD14 and Toll-like receptor 2
12624278 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12624278 The CD14 -159C/T polymorphism is associated with increased common carotid artery intima-media thickness in smokers
12594207 innate immune recognition of LTA via LBP, CD14, and TLR-2 represents an important mechanism in the pathogenesis of systemic complications in the course of infectious diseases brought about by Gram-positive pathogens. while TLR-4 and MD-2 are not involved.
12580907 Observational study of gene-disease association. (HuGE Navigator)
12566518 Observational study of gene-disease association. (HuGE Navigator)
12492251 Observational study of gene-disease association. (HuGE Navigator)
12450609 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12438323 lipopolysaccharide may induce proliferation of periodontal epithelial cells by upregulating keratinocyte growth factor 1 expression via the CD14 and Toll-like receptor signaling pathway
12414752 CD14 is significantly downregulated from the surface of HIV-1 Nef-expressing THP-1 monocytes compared to that from the surface of control cells
12410798 some heat-stable component of P. gingivalis, including LPS, may be responsible for the induction of IL-8 and MCP-1 in HUVECs by a CD14-dependent mechanism
12404174 Observational study of gene-disease association. (HuGE Navigator)
12324469 Lipopolysaccharide rapidly traffics to and from the Golgi apparatus with the toll-like receptor 4-MD-2-CD14 complex
12207338 Porphyromonas gingivalis fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12185442 Observational study of gene-disease association. (HuGE Navigator)
12174084 Data show that the TLR4-mediated LPS response in bladder epithelial cells also uses the co-receptor CD14 for efficient LPS signalling.
12171914 CD14 has a role in mediating signaling responses to Aspergillus fumigatus
12140663 Observational study of gene-disease association. (HuGE Navigator)
12140663 TT genotype of CD14 associated with risk of atherosclerotic or microangiopathic stroke
12126249 Observational study of gene-disease association. (HuGE Navigator)
12117913 plasma factor LBP and cell surface receptor CD14 were necessary for LPS activation of p38, which was tightly associated with LPS priming of the PMN respiratory burst
12103253 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12101079 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12075251 Observational study of gene-disease association. (HuGE Navigator)
12067299 Human proteinase 3 can inhibits LPS-mediated TNF-alpha production through CD14 degradation
12011764 Observational study of gene-disease association. (HuGE Navigator)
12011764 CD14 polymorphism is associated with smoking dependence
12006789 Observational study of gene-disease association. (HuGE Navigator)
11985523 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11935032 Observational study of gene-disease association. (HuGE Navigator)
11935032 No association between the CD14 C(-260)T and CD18 codon 441 gene polymorphisms and the incidence of stroke was found in a large, prospective, matched case-control sample from the Physicians' Health Study.
11932927 Though Cd14 is known to faciitate binding of several bacterial ligands to TLR, no role could be found for CD14 in C. pneumoniae binding.
11876746 The important host receptor CD14 is partially implicated in TNF, IL-1, IL-6 and MCP-1 production, while CD14-independent pathways seem to be responsible for IL-8 production after S. suis stimulation.
11854210 IFN-gamma primed CD14(high) human gingival fibroblasts to enhance production of IL-8 in response to LPS through augmentation of the CD14-TLR system
11843056 Observational study of gene-disease association. (HuGE Navigator)
11841490 Observational study of gene-disease association. (HuGE Navigator)
11841490 results suggest that the enhanced CD14 expression in psoriasis is not attributable to functional variants of CD14 (-159C/T)
11825494 Data suggest that soluble lipopolysaccharide receptor CD14 (sCD14) elevation is associated with the development of multiple organ dysfunction syndrome (MODS) after major burns.
11779220 CD14-dependent activation of NF-kappaB by filarial parasitic sheath proteins
11732288 Observational study of gene-disease association. (HuGE Navigator)
11343243 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11282774 Observational study of gene-disease association. (HuGE Navigator)
11257272 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11199329 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
11062291 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL      1 - 70
KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT     71 - 140
GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER    141 - 210
GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS    211 - 280
LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP    281 - 350
ACARSTLSVGVSGTLVLLQGARGFA                                                 351 - 375
//

Text Mined References (654)

PMID Year Title
27031691 2016 Neopterin and Soluble CD14 Levels as Indicators of Immune Activation in Cases with Indeterminate Pattern and True Positive HIV-1 Infection.
26927558 2016 [Decreased expression levels of LAG-3 and CD49b on CD14+ cells in peripheral blood of patients with recurrent spontaneous abortion].
26827181 2016 Single Nucleotide Polymorphisms in MORC4, CD14, and TLR4 Are Related to Outcome of Allogeneic Stem Cell Transplantation.
26658828 2015 Increased Protease-Activated Receptor-2 (PAR-2) Expression on CD14++CD16+ Peripheral Blood Monocytes of Patients with Severe Asthma.
26569178 2015 Soluble CD163 But Not Soluble CD14 Is Associated With Cytomegalovirus Immunoglobulin G Antibody Levels in Virologically Suppressed HIV+ Individuals.
26475135 2016 Association Between CD14 Polymorphism (-1145G/A) and Childhood Bronchial Asthma.
26462562 2015 Multiplicative interaction of functional inflammasome genetic variants in determining the risk of gout.
26443598 2016 Soluble CD14: An Independent Biomarker for the Risk of Mother-to-Child Transmission of HIV in a Setting of Preexposure and Postexposure Antiretroviral Prophylaxis.
26437765 2015 Angiogenesis related genes NOS3, CD14, MMP3 and IL4R are associated to VEGF gene expression and circulating levels in healthy adults.
26365205 2016 Association between CD14 gene promoter polymorphisms with serum total-IgE and eosinophil levels in atopic and non-atopic asthma patients in a Chinese Han population.
26296897 2015 Utility of presepsin (sCD14-ST) as a diagnostic and prognostic marker of sepsis in the emergency department.
26161395 2015 Expression of FOXP3, CD14, and ARG1 in Neuroblastoma Tumor Tissue from High-Risk Patients Predicts Event-Free and Overall Survival.
26135617 2015 Circulating classical CD14++CD16- monocytes predict shorter time to initial treatment in chronic lymphocytic leukemia patients: Differential effects of immune chemotherapy on monocyte-related membrane and soluble forms of CD163.
26081375 2015 CD14 knockdown reduces lipopolysaccharide-induced cell viability and expression of inflammation-associated genes in gastric cancer cells in vitro and in nude mouse xenografts.
26030716 2015 Clinical impact of kidney function on presepsin levels.
26020644 2015 The CD14 rs2569190 TT Genotype Is Associated with an Improved 30-Day Survival in Patients with Sepsis: A Prospective Observational Cohort Study.
25970945 Diagnostic and prognostic value of presepsin in the emergency department.
25966203 2015 Association of CD14 C159T polymorphism with atopic asthma susceptibility in children from Southeastern China: a case-control study.
25965346 2015 SP-R210 (Myo18A) Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.
25907631 2015 The anti-inflammatory effect of combined complement and CD14 inhibition is preserved during escalating bacterial load.
25854904 2015 Diagnostic and prognostic value of sCD14-ST--presepsin for patients admitted to hospital intensive care unit (ICU).
25825750 2015 CD14-expressing cancer cells establish the inflammatory and proliferative tumor microenvironment in bladder cancer.
25811314 2015 Serum Soluble CD14 in Egyptian Patients with Chronic Hepatitis C: Its Relationship to Disease Progression and Response to Treatment.
25792471 2015 Increased circulating CD14(+)HLA-DR-/low myeloid-derived suppressor cells are associated with poor prognosis in patients with small-cell lung cancer.
25766482 2015 CD14 expression is increased on monocytes in patients with anti-neutrophil cytoplasm antibody (ANCA)-associated vasculitis and correlates with the expression of ANCA autoantigens.
25722986 2015 Pathfast presepsin assay for early diagnosis of systemic inflammatory response syndrome in patients with nephrolithiasis.
25695487 2015 Vasoactive intestinal peptide induces CD14+HLA-DR?/low myeloid-derived suppressor cells in gastric cancer.
25672468 2015 Determination of reference interval for presepsin, an early marker for sepsis.
25660311 2015 HMGB1 Binds to Lipoteichoic Acid and Enhances TNF-? and IL-6 Production through HMGB1-Mediated Transfer of Lipoteichoic Acid to CD14 and TLR2.
25647501 2015 Dopamine increases CD14+CD16+ monocyte migration and adhesion in the context of substance abuse and HIV neuropathogenesis.
25636826 2015 LPS stimulation of purified human platelets is partly dependent on plasma soluble CD14 to secrete their main secreted product, soluble-CD40-Ligand.
25633197 2015 LPS receptor subunits have antagonistic roles in epithelial apoptosis and colonic carcinogenesis.
25622527 2015 The CD14 C-260T single nucleotide polymorphism (SNP) modulates monocyte/macrophage activation in treated HIV-infected individuals.
25572736 The role of TLR4 and CD14 polymorphisms in the pathogenesis of respiratory syncytial virus bronchiolitis in greek infants.
25562385 2015 Soluble CD14 is associated with markers of vascular dysfunction in bariatric surgery patients.
25497142 2015 27-Hydroxycholesterol up-regulates CD14 and predisposes monocytic cells to superproduction of CCL2 in response to lipopolysaccharide.
25432966 2015 Soluble CD14, ?-and ?-defensins in breast milk: association with the emergence of allergy in a high-risk population.
25431457 2016 The human milk oligosaccharide 2'-fucosyllactose modulates CD14 expression in human enterocytes, thereby attenuating LPS-induced inflammation.
25416051 2014 Overexpression of B7-H3 in CD14+ monocytes is associated with renal cell carcinoma progression.
25394369 2014 The association of polymorphisms of TLR4 and CD14 genes with susceptibility to sepsis in a Chinese population.
25387303 2015 Presepsin in the prognosis of infectious diseases and diagnosis of infectious disseminated intravascular coagulation: a prospective, multicentre, observational study.
25309126 2014 Usefulness of presepsin in the diagnosis of sepsis in patients with or without acute kidney injury.
25238263 2014 IL-6-stimulated CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells, are associated with progression and poor prognosis in squamous cell carcinoma of the esophagus.
25108076 2014 Extracellular vesicle protein CD14 relates to common carotid intima-media thickness in eight-year-old children.
25091944 2014 The association between C-159T polymorphism in CD14 gene and susceptibility to tuberculosis: a meta-analysis.
25063948 2014 Circulating pathogen-associated molecular pattern - binding proteins and High Mobility Group Box protein 1 in nascent metabolic syndrome: implications for cellular Toll-like receptor activity.
25059667 2014 Negative regulation of Toll-like receptor-4 signaling through the binding of glycosylphosphatidylinositol-anchored glycoprotein, CD14, with the sialic acid-binding lectin, CD33.
25046588 2014 Macrophage CD14 expression in human carotid plaques is associated with complicated lesions, correlates with thrombosis, and is reduced by angiotensin receptor blocker treatment.
25034561 2014 CD14/Toll-like receptors interact with bacteria and regulatory T-cells in the development of childhood asthma.
25001428 2015 Diagnostic and prognostic value of presepsin in preterm deliveries.
24978812 2014 Association between CD14 gene polymorphisms and cancer risk: a meta-analysis.
24933321 2014 DC-HIL+ CD14+ HLA-DR no/low cells are a potential blood marker and therapeutic target for melanoma.
24908235 2014 Rosiglitazone influences the expression of leukocyte adhesion molecules and CD14 receptor in type 2 diabetes mellitus patients.
24902762 2014 Genetic variants in endotoxin signalling pathway, domestic endotoxin exposure and asthma exacerbations.
24897401 2015 Presepsin as a potential marker for bacterial infection relapse in critical care patients. A preliminary study.
24891322 2014 Aberrant overexpression of CD14 on granulocytes sensitizes the innate immune response in mDia1 heterozygous del(5q) MDS.
24870592 2014 The association between CD14-260C/T polymorphism and malignant tumor risk: a meta-analysis of 5,603 participants.
24697307 2014 Soluble CD14 is essential for lipopolysaccharide-dependent activation of human intestinal mast cells from macroscopically normal as well as Crohn's disease tissue.
24691204 2014 Soluble CD14 is independently associated with coronary calcification and extent of subclinical vascular disease in treated HIV infection.
24659539 2014 LPS and IL-1 differentially activate mouse and human astrocytes: role of CD14.
24636145 2014 CD14(+) HLA-DR low/(-) monocytes as indicator of disease aggressiveness in B-cell non-Hodgkin lymphoma.
24627605 2014 Association of CD14/-260 polymorphism with gastric cancer risk in Highland Tibetans.
24622882 2014 Reduced toll-like receptor 9 expression on peripheral CD14+ monocytes of chronic hepatitis B patients and its restoration by effective therapy.
24612386 2014 NF-?B is activated from endosomal compartments in antiphospholipid antibodies-treated human monocytes.
24586701 2014 Plasma sCD14 as a biomarker to predict pulmonary exacerbations in cystic fibrosis.
24581860 2014 Gene expression based evidence of innate immune response activation in the epithelium with oral lichen planus.
24519436 2014 CD14 -159C/T polymorphism contributes to the susceptibility to tuberculosis: evidence from pooled 1,700 cases and 1,816 controls.
24516199 2014 Combined inhibition of complement and CD14 efficiently attenuated the inflammatory response induced by Staphylococcus aureus in a human whole blood model.
24461398 2014 Polymorphism of the CD14 and TLR4 genes and post-treatment apical periodontitis.
24419414 2014 Circulating CD14+CD204+ cells predict postoperative recurrence in non-small-cell lung cancer patients.
24401216 2014 Reduced CD14 expression on classical monocytes and vascular endothelial adhesion markers independently associate with carotid artery intima media thickness in chronically HIV-1 infected adults on virologically suppressive anti-retroviral therapy.
24398371 2015 Extracellular vesicle-derived CD14 is independently associated with the extent of cardiovascular disease burden in patients with manifest vascular disease.
24393424 2014 Presepsin (soluble CD14 subtype) and procalcitonin levels for mortality prediction in sepsis: data from the Albumin Italian Outcome Sepsis trial.
24347797 2013 CD14 gene variants and their importance for childhood croup, atopy, and asthma.
24333662 2014 CD14(bright)CD16(low) intermediate monocytes expressing Tie2 are increased in the peripheral blood of patients with primary myelofibrosis.
24314935 2013 Toll-like receptor 4 and CD14 gene polymorphisms in Tunisian kidney transplantation.
24275652 2014 CD14 mediates Toll-like receptor 4 (TLR4) endocytosis and spleen tyrosine kinase (Syk) and interferon regulatory transcription factor 3 (IRF3) activation in epithelial cells and impairs neutrophil infiltration and Pseudomonas aeruginosa killing in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24172224 2014 Anti-CD14 antibody reduces LPS responsiveness via TLR4 internalization in human monocytes.
24170183 2014 Association of CD14 gene -159C/T polymorphism with allergic rhinitis risk: a meta-analysis.
24147858 2013 Impact of CD14 promoter variants on measles vaccine responses and vaccine failure in children from Australia and Mozambique.
24144680 TLR2-TLR4/CD14 polymorphisms and predisposition to severe invasive infections by Neisseria meningitidis and Streptococcus pneumoniae.
24125453 2013 Contribution of CD14-159C/T polymorphism to tuberculosis susceptibility: a meta-analysis.
24116867 2014 VB-201, an oxidized phospholipid small molecule, inhibits CD14- and Toll-like receptor-2-dependent innate cell activation and constrains atherosclerosis.
24086515 2013 Serum soluble CD14 is a potential prognostic indicator of recurrence of human breast invasive ductal carcinoma with Her2-enriched subtype.
24077340 2013 Association of inflammatory gene polymorphisms and conventional risk factors with arterial stiffness by age.
24076253 2014 Presepsin (sCD14-ST) in emergency department: the need for adapted threshold values?
24074718 2014 Evaluation of soluble CD14 subtype (presepsin) in burn sepsis.
24068451 2014 Binding of CD14 to Mycoplasma genitalium-derived lipid-associated membrane proteins upregulates TNF-?.
24064911 2013 CD14 regulates gastric cancer cell epithelial?mesenchymal transition and invasion in vitro.
24046527 2013 The -159C/T polymorphism in the CD14 gene and tuberculosis risk: a meta-analysis.
24044964 CD14 tobacco gene-environment interaction in atopic children.
23990939 2013 Association between CD14 promoter -159C/T polymorphism and the risk of sepsis and mortality: a systematic review and meta-analysis.
23936239 2013 The N-terminus of CD14 acts to bind apoptotic cells and confers rapid-tethering capabilities on non-myeloid cells.
23880187 2013 CD14 and TLR4 mediate cytokine release promoted by electronegative LDL in monocytes.
23824692 2014 Polymorphisms of Helicobacter pylori signaling pathway genes and gastric cancer risk in the European Prospective Investigation into Cancer-Eurgast cohort.
23796347 2014 Association of TLR2, TLR3, TLR4 and CD14 genes polymorphisms with oral cancer risk and survival.
23786414 2013 Biologically relevant doses of mixed aflatoxins B and G up-regulate MyD88, TLR2, TLR4 and CD14 transcripts in human PBMCs.
23770267 2013 The CD14--159C/T polymorphisms and the risks of tuberculosis: a meta-analysis.
23762319 2013 Soluble CD14 levels reflect liver inflammation in patients with nonalcoholic steatohepatitis.
23748193 2013 An association between adiposity and serum levels of macrophage inflammatory protein-1? and soluble CD14 in HIV-infected adults: results from a cross-sectional study.
23741383 2013 CD14 -159 C>T gene polymorphism with increased risk of tuberculosis: evidence from a meta-analysis.
23679818 2013 Engagement of CD14 sensitizes primary monocytes to IFN-? to produce IL-12/23p40 and IL-23 through p38 mitogen-activated protein kinase and independent of the janus kinase/signal transducers and activators of transcription signaling.
23589304 2013 Lgr4/Gpr48 negatively regulates TLR2/4-associated pattern recognition and innate immunity by targeting CD14 expression.
23587862 2013 Association between CD14-159C>T polymorphisms and the risk for alcoholic liver disease: a meta-analysis.
23582034 2013 Association between CD14 gene polymorphism and periodontitis: a meta-analysis.
23565226 2013 The role of TLR2, TLR4 and CD14 genetic polymorphisms in gastric carcinogenesis: a case-control study and meta-analysis.
23537804 2013 CD14 directs adventitial macrophage precursor recruitment: role in early abdominal aortic aneurysm formation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23517107 2013 Associations between CD14 -159 C>T polymorphism and chronic/aggressive periodontitis susceptibility.
23510625 2013 The predictive value of soluble biomarkers (CD14 subtype, interleukin-2 receptor, human leucocyte antigen-G) and procalcitonin in the detection of bacteremia and sepsis in pediatric oncology patients with chemotherapy-induced febrile neutropenia.
23430250 2013 Human lipopolysaccharide-binding protein (LBP) and CD14 independently deliver triacylated lipoproteins to Toll-like receptor 1 (TLR1) and TLR2 and enhance formation of the ternary signaling complex.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23371544 2013 Prognostic implications of CD14 positivity in acute myeloid leukemia arising from myelodysplastic syndrome.
23338226 2013 CD14 overexpression upregulates TNF-?-mediated inflammatory responses and suppresses the malignancy of gastric carcinoma cells.
23277403 2013 The association between CD14 gene C-260T polymorphism and coronary heart disease risk: a meta-analysis.
23264655 2013 The crystal structure of human soluble CD14 reveals a bent solenoid with a hydrophobic amino-terminal pocket.
23206327 2012 Menopause leads to elevated expression of macrophage-associated genes in the aging frontal cortex: rat and human studies identify strikingly similar changes.
23201091 2013 Lipopolysaccharide causes an increase in intestinal tight junction permeability in vitro and in vivo by inducing enterocyte membrane expression and localization of TLR-4 and CD14.
23194293 2012 Pet keeping and tobacco exposure influence CD14 methylation in childhood.
23162132 2012 Potent induction of antibody-secreting B cells by human dermal-derived CD14+ dendritic cells triggered by dual TLR ligation.
23162014 2013 Soluble CD14: genomewide association analysis and relationship to cardiovascular risk and mortality in older adults.
23146639 2012 Association among oral health, apical periodontitis, CD14 polymorphisms, and coronary heart disease in middle-aged adults.
23135962 2013 CD14 and IL6 polymorphisms are associated with a pro-atherogenic profile in young adults with acute myocardial infarction.
23121673 2012 Chronic immune activation in common variable immunodeficiency (CVID) is associated with elevated serum levels of soluble CD14 and CD25 but not endotoxaemia.
23107636 2012 Association between the CD14 gene C-159T polymorphism and serum soluble CD14 with pulmonary tuberculosis.
23101184 2012 Association between the functional polymorphism C-159T in the CD14 promoter gene and nasal polyposis: potential role in asthma.
23079836 2012 Association of CD14 G(-1145)A and C(-159)T polymorphisms with reduced risk for tuberculosis in a Chinese Han population.
23049772 2012 Association between CD14 gene C-260T polymorphism and inflammatory bowel disease: a meta-analysis.
23046822 2012 Clinical application of human ?-defensin and CD14 gene polymorphism in evaluating the status of chronic inflammation.
23036271 2013 The role of CD14 gene promoter polymorphism in tuberculosis susceptibility.
23036097 2013 The synergy of -260T T CD14 and -308GG TNF-? genotypes in survival of critically ill patients.
23009036 2013 Polymorphisms of the CD14 genes are associated with susceptibility to alcoholic liver disease in Greek patients.
23000519 2012 Protosappanin A inhibits oxidative and nitrative stress via interfering the interaction of transmembrane protein CD14 with Toll-like receptor-4 in lipopolysaccharide-induced BV-2 microglia.
22999728 2012 CD14++CD16+ monocytes independently predict cardiovascular events: a cohort study of 951 patients referred for elective coronary angiography.
22961048 2013 Selective expansion of pro-inflammatory chemokine CCL2-loaded CD14+CD16+ monocytes subset in HIV-infected therapy naïve individuals.
22937756 2012 Polymorphisms in the promoter of the CD14 gene and their associations with susceptibility to pulmonary tuberculosis.
22812245 2012 [The role of CD14 promoter - 159 C-> T polymorphism on changes of serum lipid ratios induced by high-carbohydrate/low-fat diets in healthy Chinese Han youth].
22737215 2012 Augmented TLR2 expression on monocytes in both human Kawasaki disease and a mouse model of coronary arteritis.
22703766 2012 Lack of association of the CD14/C -- 159T polymorphism with susceptibility and progression parameters in Turkish multiple sclerosis patients.
22697010 2012 Association between tuberculosis and atopy: role of the CD14-159C/T polymorphism.
22648004 2012 CD14 polymorphisms correlate with an augmented risk for celiac disease in Italian patients.
22605977 2012 CARD15/NOD2, CD14 and toll-like 4 receptor gene polymorphisms in Saudi patients with Crohn's Disease.
22564189 2012 DNA methylation levels within the CD14 promoter region are lower in placentas of mothers living on a farm.
22482418 2012 [Expression and clinical significance of PD-L1 on CD14? monocyte in the peripheral blood of patients with systemic lupus erythematosus].
22445606 2012 Cd14 SNPs regulate the innate immune response.
22384567 2011 [Study on the relationship between SNP of CD14 gene and allergic rhinitis in Xinjiang Uygurs and Hans].
22376040 2012 Gene-gene interactions between candidate gene polymorphisms are associated with total IgE levels in Korean children with asthma.
22363790 2012 Circulating sCD14 is associated with virological response to pegylated-interferon-alpha/ribavirin treatment in HIV/HCV co-infected patients.
22265692 2012 Follistatin-related protein/follistatin-like 1 evokes an innate immune response via CD14 and toll-like receptor 4.
22260507 2012 Toll-like receptor (TLR) 3 immune modulation by unformulated small interfering RNA or DNA and the role of CD14 (in TLR-mediated effects).
22232682 2012 CD14 cooperates with complement receptor 3 to mediate MyD88-independent phagocytosis of Borrelia burgdorferi.
22219617 2012 Association between toll-like receptors/CD14 gene polymorphisms and inflammatory bowel disease in Korean population.
22056216 2012 CRP and CD14 polymorphisms correlate with coronary plaque volume in patients with coronary artery disease--IVUS substudy of the ENCORE trials.
22015088 2011 CD14 gene polymorphism is not associated with asthma but rather with bronchial obstruction and hyperreactivity in Slovenian children with non-atopic asthma.
22014346 2011 Association of CD14+ monocyte-derived progenitor cells with cardiac allograft vasculopathy.
21948372 2012 Differential effect of inhibiting MD-2 and CD14 on LPS- versus whole E. coli bacteria-induced cytokine responses in human blood.
21921097 2011 Soluble CD14 and CD14 polymorphisms in rheumatoid arthritis.
21905503 2011 Promoter polymorphisms of the CD14 gene are associated with atopy in Pakistani adults.
21885391 2012 Respiratory health and endotoxin: associations and modification by CD14/-260 genotype.
21842127 Association between gene polymorphism of CD14-159 (C/T) and allergic asthma.
21808991 2012 CD14-/CD34+ is the founding population of umbilical cord blood-derived endothelial progenitor cells and angiogenin1 is an important factor promoting the colony formation.
21799175 2011 CD14dimCD16+ and CD14+CD16+ monocytes in obesity and during weight loss: relationships with fat mass and subclinical atherosclerosis.
21745379 2011 Association of CD14 -260 (-159) C>T and asthma: a systematic review and meta-analysis.
21740312 2011 Soluble CD14 subtype presepsin (sCD14-ST) and lipopolysaccharide binding protein (LBP) in neonatal sepsis: new clinical and analytical perspectives for two old biomarkers.
21722015 2011 LBP and sCD14 patterns in total hip replacement surgery performed during combined spinal/epidural anaesthesia.
21705839 2011 Down-regulation of CD14 transcripts in human glioblastoma cell line U87 MG.
21700881 2011 CD14 modulates inflammation-driven insulin resistance.
21633598 2011 LBP and CD14 polymorphisms correlate with increased colorectal carcinoma risk in Han Chinese.
21596674 2011 Single nucleotide polymorphisms in the promoter of the gene encoding the lipopolysaccharide receptor CD14 are associated with bacterial diarrhea in US and Canadian travelers to Mexico.
21498585 2011 Membrane CD14, but not soluble CD14, is used by exoenzyme S from P. aeruginosa to signal proinflammatory cytokine production.
21489615 2011 Hexamethylene diisocyanate asthma is associated with genetic polymorphisms of CD14, IL-13, and IL-4 receptor ?.
21476947 2011 Genetic variations in CD14 promoter and acute lymphoblastic leukemia susceptibility in a Chinese population.
21389010 2011 Endotoxin exposure, CD14 and wheeze among farmers: a gene--environment interaction.
21361908 2011 CD16+ monocytes in breast cancer patients: expanded by monocyte chemoattractant protein-1 and may be useful for early diagnosis.
21333644 2011 C(-260)T polymorphism in the promoter of CD 14 gene is not associated with myocardial infarction in the Tunisian population.
21303362 2011 Elevated blood levels of inflammatory monocytes (CD14+ CD16+ ) in patients with complex regional pain syndrome.
21293259 2011 Comparative analysis of detecting monocytic cells and their aberrancy.
21278688 2011 Lack of effect of the CD14 promoter gene C-159T polymorphism on nutritional status parameters in hemodialysis patients.
21277522 2011 Association of genetic variants of CD14 with peanut allergy and elevated IgE levels in peanut allergic individuals.
21257965 2011 Two unique human decidual macrophage populations.
21253969 2011 Expression of Toll-like receptor 4, CD14, and NF-?B in Chinese patients with ulcerative colitis.
21209279 2011 c-Maf-dependent growth of Mycobacterium tuberculosis in a CD14(hi) subpopulation of monocyte-derived macrophages.
21191073 2011 Senescent CD14+CD16+ monocytes exhibit proinflammatory and proatherosclerotic activity.
21178007 2011 TLR 2 and CD14 mediate innate immunity and lung inflammation to staphylococcal Panton-Valentine leukocidin in vivo.
21172039 2010 Endotoxin and CD14 in the progression of biliary atresia.
21118416 2011 Single nucleotide polymorphisms of pattern recognition receptors and chronic periodontitis.
21084593 2010 Deletion of CD14 attenuates Alzheimer's disease pathology by influencing the brain's inflammatory milieu.
21079949 2011 The -159C/T polymorphism in the CD14 gene and the risk of asthma: a meta-analysis.
21063024 2011 Immunosuppressive CD14+HLA-DR(low)/- monocytes in B-cell non-Hodgkin lymphoma.
21062235 2011 Identification and immunolocalization of the innate immune receptor CD14 in hypertrophic adenoids and tonsils.
21052690 2011 The 5352 A allele of the pro-inflammatory caspase-1 gene predicts late-acquired stent malapposition in STEMI patients treated with sirolimus stents.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
21041645 2010 Experimental human cytomegalovirus latency in CD14+ monocytes.
21039068 2010 NOD2, CD14 and TLR4 mutations do not influence response to adalimumab in patients with Crohn's disease: a preliminary report.
20964518 2011 Coexpression of CD14 and CD326 discriminate hepatic precursors in the human fetal liver.
20876990 2010 Association of salivary sCD14 concentration levels with early childhood caries.
20865702 2011 Serum lipopolysaccharide-binding protein and soluble CD14 are markers of disease activity in patients with Crohn's disease.
20860622 2010 DIP2 disco-interacting protein 2 homolog A (Drosophila) is a candidate receptor for follistatin-related protein/follistatin-like 1--analysis of their binding with TGF-? superfamily proteins.
20832340 2010 Human CD14dim monocytes patrol and sense nucleic acids and viruses via TLR7 and TLR8 receptors.
20826579 2010 Abrogation of TLR4 and CD14 expression and signaling in human adrenocortical tumors.
20730440 2011 Genetic factors responsible for long bone fractures non-union.
20723409 2010 [Influence of CD14 gene polymorphism on the expression of high mobility group box-1 protein in patients with severe burn].
20717070 2010 Alpha-lactalbumin in human milk alters the proteolytic degradation of soluble CD14 by forming a complex.
20703737 2012 The association forecasting of 13 variants within seven asthma susceptibility genes on 3 serum IgE groups in Taiwanese population by integrating of adaptive neuro-fuzzy inference system (ANFIS) and classification analysis methods.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20660791 2010 Soluble CD14 is a novel monocyte-derived survival factor for chronic lymphocytic leukemia cells, which is induced by CLL cells in vitro and present at abnormally high levels in vivo.
20636398 2010 Circulating CD14(+) CD16(+) monocyte levels predict tissue invasive character of cholangiocarcinoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20618347 2010 CD14, a key candidate gene associated with a specific immune response to cockroach.
20608916 2011 The effect of CD14 C159T polymorphism on in vitro IgE synthesis and cytokine production by PBMC from children with asthma.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20587312 2010 [The significance of CD14 and TLR4 expressions in severe hepatitis B induced by endotoxin].
20579716 2010 Gene-environment interactions influence airways function in laboratory animal workers.
20555320 2010 Renal CD14 expression correlates with the progression of cystic kidney disease.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20536280 2010 Genetic polymorphism of manganese superoxide dismutase is associated with childhood asthma.
20532808 2010 Interleukin-33 stimulates formation of functional osteoclasts from human CD14(+) monocytes.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20485444 2010 Common polymorphisms in ITGA2, PON1 and THBS2 are associated with coronary atherosclerosis in a candidate gene association study of the Chinese Han population.
20472613 2011 CD14 (C-260T) polymorphism is not associated with sudden infant death syndrome (SIDS) in a large South Australian cohort.
20472010 2010 Activation of TLR2 and TLR4 by minimally modified low-density lipoprotein in human macrophages and monocytes triggers the inflammatory response.
20463618 2010 Role of polymorphic variants as genetic modulators of infection in neonatal sepsis.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20430725 2009 Different expression of CD180, CD284 and CD14 receptors on the CD19+ subpopulation of normal and B-CLL lymphocytes.
20430603 2010 Association between CD14 gene polymorphisms and disease phenotype in sarcoidosis.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20398919 2010 CD14 polymorphisms and serum CD14 levels through childhood: a role for gene methylation?
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20394509 2010 Association and gene-gene interactions of eight common single-nucleotide polymorphisms with pediatric asthma in middle china.
20384875 2010 sCD14 in bronchoalveolar lavage 18, 42 and 162 hours after segmental allergen provocation.
20381257 2010 Pathway genetic load allows simultaneous evaluation of multiple genetic associations.
20377740 2010 Inhibitory effects of soluble MD-2 and soluble CD14 on bacterial growth.
20364047 2010 CD14CD16 monocyte subset levels in heart failure patients.
20363151 2010 Interleukin 10 polymorphisms differentially influence the risk of gastric cancer in East Asians and Caucasians.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20302606 2010 Expression, regulation and clinical significance of soluble and membrane CD14 receptors in pediatric inflammatory lung diseases.
20227257 2011 Polymorphisms in the platelet-specific collagen receptor GP6 are associated with risk of nonfatal myocardial infarction in Caucasians.
20219985 2010 Glutathione peroxidase-1 modulates lipopolysaccharide-induced adhesion molecule expression in endothelial cells by altering CD14 expression.
20207250 2010 The association of innate immune response gene polymorphisms and puerperal group A streptococcal sepsis.
20179016 2010 Systemic immune suppression in glioblastoma: the interplay between CD14+HLA-DRlo/neg monocytes, tumor factors, and dexamethasone.
20163933 2010 Polymorphisms of genes encoding tumor necrosis factor-alpha, interleukin-10, cluster of differentiation-14 and interleukin-1ra in critically ill patients.
20133493 2010 Lipopolysaccharide-binding protein-mediated Toll-like receptor 4 dimerization enables rapid signal transduction against lipopolysaccharide stimulation on membrane-associated CD14-expressing cells.
20113368 2010 The Toll-like receptor 2 (TLR2) ligand FSL-1 is internalized via the clathrin-dependent endocytic pathway triggered by CD14 and CD36 but not by TLR2.
20109750 2010 Host-microbial interactions in childhood atopy: toll-like receptor 4 (TLR4), CD14, and fecal Escherichia coli.
20109306 Association of the CD14 gene polymorphism C-159T with allergic rhinitis.
20092898 2010 Meconium-induced release of cytokines is mediated by the TRL4/MD-2 complex in a CD14-dependent manner.
20085599 2009 A multi-centre study of candidate genes for wheeze and allergy: the International Study of Asthma and Allergies in Childhood Phase 2.
20039305 2010 CD14-independent responses induced by a synthetic lipid A mimetic.
19997857 2010 -651C/T promoter polymorphism in the CD14 gene is associated with severity of acute pancreatitis in Japan.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19928913 2009 Evidence of a specific interaction between new synthetic antisepsis agents and CD14.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19892918 2009 Genetic risk factors for periodontitis in a Japanese population.
19860589 2009 The influences of CD14 -260C>T polymorphism on survival in ICU critically ill patients.
19847953 2007 Association of polymorphism of TLR4 and CD14 genes with gastroduodenal diseases in Japan.
19845895 2009 Fine mapping of the CELIAC2 locus on chromosome 5q31-q33 in the Finnish and Hungarian populations.
19838169 2009 Enrichment of glycopeptides for glycan structure and attachment site identification.
19830784 2010 Association of CD14 variant with prostate cancer in African American men.
19829130 2010 Role of the CD14 C(-260)T promoter polymorphism in determining the first clinical manifestation of coronary artery disease.
19824106 2009 Role of LPS/CD14/TLR4-mediated inflammation in necrotizing enterocolitis: pathogenesis and therapeutic implications.
19809507 2009 CD14 C-159T and toll-like receptor 4 Asp299Gly polymorphisms in surviving meningococcal disease patients.
19799036 2009 [Distribution and clinical significance of CD14 promoter-159C/T polymorphism in patients with extensive burn].
19795323 2009 CD14 promoter polymorphism (- 159C-->t) is not associated with myocardial infarction or coronary artery disease in patients with assumed high genetic risk.
19761511 2010 CD14 polymorphisms in mother and infant, soluble CD14 in breast milk and atopy development in the infant (KOALA Study).
19758335 2009 Association between the -159C/T CD14 gene polymorphism and tuberculosis in a Korean population.
19741468 2009 Impact of polymorphisms of TLR4/CD14 and TLR3 on acute rejection in kidney transplantation.
19733948 2009 Soluble CD14 levels, interleukin 6, and mortality among prevalent hemodialysis patients.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19701968 2009 Endotoxin receptor CD14 gene variants and histological features in chronic HCV infection.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19674346 2009 Polymorphisms in inflammation genes, tobacco smoke and furred pets and wheeze in children.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19605672 2009 The association with the -159C/T polymorphism in the promoter region of the CD14 gene and juvenile idiopathic arthritis in a Chinese Han population.
19595045 2009 [Study on the correlation between CD14 gene polymorphism and T cell-mediated immunity in severely burned patients].
19584052 2009 Anionic pulmonary surfactant phospholipids inhibit inflammatory responses from alveolar macrophages and U937 cells by binding the lipopolysaccharide-interacting proteins CD14 and MD-2.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19572148 2010 Population alterations of L-arginase- and inducible nitric oxide synthase-expressed CD11b+/CD14?/CD15+/CD33+ myeloid-derived suppressor cells and CD8+ T lymphocytes in patients with advanced-stage non-small cell lung cancer.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19550115 2009 Comparative proteomics analysis on differentiation of human promyelocytic leukemia HL-60 cells into granulocyte and monocyte lineages.
19536153 2009 Sex-specific effect of IL9 polymorphisms on lung function and polysensitization.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19522765 2009 Effects of CD14, TLR2, TLR4, LPB, and IL-6 gene polymorphisms on Chlamydia pneumoniae growth in human macrophages in vitro.
19508433 2009 Genetic variants in immunoregulatory genes and risk for childhood lymphomas.
19500269 2009 Serum sCD14, polymorphism of CD14(-260) and periodontal infection.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19468702 2009 Functional impact of endotoxin receptor CD14 polymorphisms on transcriptional activity.
19466271 2009 Association of MBL2, TGF-beta1 and CD14 gene polymorphisms with lung disease severity in cystic fibrosis.
19447482 2009 CD14 and IL4R gene polymorphisms modify the effect of day care attendance on serum IgE levels.
19433913 2009 CD14 C260T promoter polymorphism and the risk of cerebrovascular diseases: a meta-analysis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19420105 2009 A candidate gene approach to genetic prognostic factors of IgA nephropathy--a result of Polymorphism REsearch to DIstinguish genetic factors Contributing To progression of IgA Nephropathy (PREDICT-IgAN).
19390489 2009 Distinct roles of TLR4 and CD14 in LPS-induced inflammatory responses of neonates.
19365146 2009 mCD14 expression in human monocytes is downregulated by ouabain via transactivation of epithelial growth factor receptor and activation of p38 mitogen-activated protein kinase.
19361972 2009 Influence of C-159T SNP of the CD14 gene promoter on lung function in smokers.
19360901 2009 Role of soluble CD14 in cerebrospinal fluid as a regulator of glial functions.
19346955 2009 CD14 C-260T gene polymorphism and ischemic heart disease susceptibility: a HuGE review and meta-analysis.
19337058 2009 CD14-159C/T and TLR9-1237T/C polymorphisms are not associated with gastric cancer risk in Caucasian populations.
19318422 2009 Soluble CD14 in periodontitis.
19275920 2009 Interactions among genes influencing bacterial recognition increase IBD risk in a population-based New Zealand cohort.
19264973 2009 Assessing the reproducibility of asthma candidate gene associations, using genome-wide data.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19242719 2009 The detection of CD14 and CD16 in paraffin-embedded bone marrow biopsies is useful for the diagnosis of chronic myelomonocytic leukemia.
19225544 2009 Variation in the lymphotoxin-alpha/tumor necrosis factor locus modifies risk of erythema nodosum in sarcoidosis.
19222419 2009 Opposite gene by environment interactions in Karelia for CD14 and CC16 single nucleotide polymorphisms and allergy.
19210273 2009 A pilot study of genetic polymorphisms and hemodialysis vascular access thrombosis.
19200604 2009 Gene polymorphisms of Toll-like and related recognition receptors in relation to the vaginal carriage of Gardnerella vaginalis and Atopobium vaginae.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19189651 Association of polymorphisms of NOD2, TLR4 and CD14 genes with susceptibility to gastric mucosa-associated lymphoid tissue lymphoma.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19148143 2009 A TLR2 polymorphism is associated with type 1 diabetes and allergic asthma.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19096003 2009 CD14 and toll-like receptor gene polymorphisms, country living, and asthma in adults.
19060757 Tumor necrosis factor gene variation and the risk of mortality after burn injury: a cohort study.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19046305 2008 Impact of genetic variants of CD14 and TLR4 on subgingival periodontopathogens.
19037967 2008 Interaction between CD14-159C>T polymorphism and Helicobacter pylori is associated with serum total immunoglobulin E.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
19027777 2009 Upregulated ex vivo expression of stress-responsive inflammatory pathway genes by LPS-challenged CD14(+) monocytes in frail older adults.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19010986 2009 Lipopolysaccharide-binding protein and CD14 are increased in the bronchoalveolar lavage fluid of smokers.
19006850 2008 Association between the polymorphisms of TLR4 and CD14 genes and Alzheimer's disease.
18991094 2008 CD14 expression in the first 24h of sepsis: effect of -260C>T CD14 SNP.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18974842 2008 Gender differences in genetic risk profiles for cardiovascular disease.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18951711 2009 Influence of CD14 polymorphism on CD14 expression in patients with extensive burns.
18938271 2008 Estimation of sCD14 levels in saliva obtained from patients with various periodontal conditions.
18931892 2009 An association study of 13 SNPs from seven candidate genes with pediatric asthma and a preliminary study for genetic testing by multiple variants in Taiwanese population.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18794053 2008 The association of C (-260)-->T polymorphism in CD14 promoter and Chlamydia pneumoniae infection in ischemic stroke patients.
18774388 2008 Genetic variation in immune signaling genes differentially expressed in asthmatic lung tissues.
18767926 2009 CD33+ CD14- phenotype is characteristic of multinuclear osteoclast-like cells in giant cell tumor of bone.
18728522 2008 Frequencies of genetic polymorphisms of TLR4 and CD14 and of HLA-DQ genotypes in children with celiac disease, type 1 diabetes mellitus, or both.
18714537 2008 Analysis of -675 4 g/5 G SERPINE1 and C-159T CD14 polymorphisms in house dust mite-allergic asthma patients.
18691306 2008 Study of gene-gene interactions for endophenotypic quantitative traits in Chinese asthmatic children.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18666712 2008 CD14-159 and -260 gene polymorphisms are associated with HBV-related cirrhotic injury in Chinese Han patients.
18664531 2008 Exercise training-induced lowering of inflammatory (CD14+CD16+) monocytes: a role in the anti-inflammatory influence of exercise?
18634146 2008 Toll-like receptor 4 and CD14 polymorphisms in ankylosing spondylitis: evidence of a weak association in Finns.
18606699 2008 Varying importance of soluble and membrane CD14 in endothelial detection of lipopolysaccharide.
18596635 2008 Functional significance of CD14 promoter polymorphisms and their clinical relevance in a Chinese Han population.
18580477 2008 Increased donor CD86+CD14+ cells in the bone marrow and peripheral blood of patients with chronic graft-versus-host disease.
18580445 2008 Polymorphisms of the TNF, CD14, and HSPA1B genes in patients with acute alcohol-induced pancreatitis.
18571004 2008 159C>T CD14 genotype--functional effects on innate immune responses in term neonates.
18565258 Genetic contribution of the CD14 -159C/T dimorphism in the promoter region in Japanese RA.
18519568 2008 Isolation of monomeric and dimeric secreted MD-2. Endotoxin.sCD14 and Toll-like receptor 4 ectodomain selectively react with the monomeric form of secreted MD-2.
18497880 2008 Unique CD14 intestinal macrophages contribute to the pathogenesis of Crohn disease via IL-23/IFN-gamma axis.
18496988 2007 CD14 genetics in sarcoidosis patients; who's in control?
18495781 2008 Myeloid cell differentiation in response to calcitriol for expression CD11b and CD14 is regulated by myeloid zinc finger-1 protein downstream of phosphatidylinositol 3-kinase.
18458151 2008 Cellular trafficking of lipoteichoic acid and Toll-like receptor 2 in relation to signaling: role of CD14 and CD36.
18426570 2008 Endotoxin receptor CD14 in PiZ alpha-1-antitrypsin deficiency individuals.
18425216 Association of TGF-beta1, CD14, IL-4, IL-4R and ADAM33 gene polymorphisms with asthma severity in children and adolescents.
18417506 2008 Interleukin 13, CD14, pet and tobacco smoke influence atopy in three Dutch cohorts: the allergenic study.
18415752 2008 Relevance of endotoxin receptor CD14 and TLR4 gene variants in chronic liver disease.
18414664 2008 Sialoadhesin expressed on IFN-induced monocytes binds HIV-1 and enhances infectivity.
18385826 2008 A Genetic Variant of the CD14 C-159T in Patients with Functional Dyspepsia (FD) in Japanese Subjects.
18354240 2008 The presence of activated CD4(+) T cells is essential for the formation of colony-forming unit-endothelial cells by CD14(+) cells.
18320914 2008 Gene-environment interactions between CD14 C-260T and endotoxin exposure on Foxp3+ and Foxp3- CD4+ lymphocyte numbers and total serum IgE levels in early childhood.
18315435 2008 Local expression of interleukin-10 and mCD14 in relation to the -1087 IL-10 and -159 CD14 gene polymorphisms in chronic periodontitis.
18312481 2008 Toll-like receptors and CD14 genes polymorphisms and susceptibility to asthma in Tunisian children.
18288274 2007 Lipopolysaccharide binding protein and sCD14 are not produced as acute phase proteins in cardiac surgery.
18182917 Epistatic interactions are critical to gene-association studies: PAI-1 and risk for mortality after burn injury.
18180796 Clinical relevance of TLR2, TLR4, CD14 and FcgammaRIIA gene polymorphisms in Streptococcus pneumoniae infection.
18180316 2008 High glucose enhances lipopolysaccharide-stimulated CD14 expression in U937 mononuclear cells by increasing nuclear factor kappaB and AP-1 activities.
18174680 2007 The c.1-260C>T promoter variant of CD14 but not the c.896A>G (p.D299G) variant of toll-like receptor 4 (TLR4) genes is associated with inflammatory bowel disease.
18158110 2008 Inflammatory system gene polymorphism and the risk of stroke: a case-control study in an Indian population.
18157711 2009 Association between inflammatory gene polymorphisms and coronary artery disease in an Indian population.
18067042 2007 Association between decreased kidney function and endotoxin receptor CD14 C-159T polymorphism among Japanese health check-up examinees.
18057002 2008 The differential impact of disulfide bonds and N-linked glycosylation on the stability and function of CD14.
18056918 2008 Low potency of Chlamydophila LPS to activate human mononuclear cells due to its reduced affinities for CD14 and LPS-binding protein.
18040078 2008 Expression of Toll-like receptor 2 (TLR2), TLR4, and CD14 in biopsy samples of patients with inflammatory bowel diseases: upregulated expression of TLR2 in terminal ileum of patients with ulcerative colitis.
18008256 2007 CD14 C(-159)T polymorphism is a risk factor for development of pulmonary tuberculosis.
17982638 2007 Antioxidants and doxorubicin supplementation to modulate CD14 expression and oxidative stress induced by vitamin D3 and seocalcitol in HL60 cells.
17949800 2008 Association between CD14 polymorphisms and serum soluble CD14 levels: effect of atopy and endotoxin inhalation.
17943182 2008 Histone acetylation in keratinocytes enables control of the expression of cathelicidin and CD14 by 1,25-dihydroxyvitamin D3.
17934216 2007 Transfer of monomeric endotoxin from MD-2 to CD14: characterization and functional consequences.
17925604 2007 CD14+ monocyte levels in subgroups of acute coronary syndromes.
17919709 2007 A polymorphism in CD14 modifies the effect of farm milk consumption on allergic diseases and CD14 gene expression.
17916440 2008 Soluble CD14 and toll-like receptor-2 are potential salivary biomarkers for oral lichen planus and burning mouth syndrome.
17913858 2007 High prevalence of the CD14-159CC genotype in patients infected with severe acute respiratory syndrome-associated coronavirus.
17900622 2008 Interaction between CD14 and LXRbeta genes modulates Alzheimer's disease risk.
17877801 2007 Common TNF-alpha, IL-1 beta, PAI-1, uPA, CD14 and TLR4 polymorphisms are not associated with disease severity or outcome from Gram negative sepsis.
17877764 2007 Atopy and new-onset asthma in young Danish farmers and CD14, TLR2, and TLR4 genetic polymorphisms: a nested case-control study.
17869646 2007 Interleukin-10 enhances the CD14-dependent phagocytosis of bacteria and apoptotic cells by human monocytes.
17846597 2007 Significance of CTLA-4 and CD14 genetic polymorphisms in clinical outcome after allogeneic stem cell transplantation.
17802898 2007 Chronic infections and genetic factors in the development of ischemic stroke.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17653770 2007 Synergistic contribution of CD14 and HLA loci in the susceptibility to Buerger disease.
17617027 2007 High-sensitivity C-reactive protein concentration in patients with myocardial infarction-environmental factors, and polymorphisms in interleukin-10 and CD14 genes.
17607003 2007 CD14, endotoxin, and asthma risk: actions and interactions.
17600225 2007 Enhanced levels of oxidized low-density lipoprotein prime monocytes to cytokine overproduction via upregulation of CD14 and toll-like receptor 4 in unstable angina.
17565650 2007 Genetic polymorphisms of CD14 and Toll-like receptor-2 (TLR2) in patients with ulcerative colitis.
17515856 2007 Effects of CD14-159 C/T polymorphism on CD14 expression and the balance between proinflammatory and anti-inflammatory cytokines in whole blood culture.
17511783 2007 Association of CD14, IL1B, IL6, IL10 and TNFA functional gene polymorphisms with symptomatic dental abscesses.
17471431 2007 CD14 -550 C/T, which is related to the serum level of soluble CD14, is associated with the development of respiratory syncytial virus bronchiolitis in the Japanese population.
17456337 2007 [Association of CD14 gene polymorphism with atopic diseases in Chinese Han ethnic group children].
17448042 2007 Polymorphisms in the CD14 and IL-6 genes associated with periodontal disease.
17438094 2007 Role of CD14 promoter polymorphisms in Helicobacter pylori infection--related gastric carcinoma.
17436151 2007 CD14 gene polymorphism 159C/T in a group of patients with coronary artery disease from a population with high morbidity of cardiovascular diseases.
17309585 2007 Polymorphisms of TLR4 but not CD14 are associated with a decreased risk of aggressive periodontitis.
17304102 2007 CD14-159 C allele is associated with increased risk of mortality after burn injury.
17274987 2007 CD14 is a ligand for the integrin alpha4beta1.
17264400 2006 TLR-4 and CD14 polymorphisms in respiratory syncytial virus associated disease.
17259806 2007 No association of polymorphisms in the 5' region of the CD14 gene and food allergy in a Japanese population.
17217435 2007 Genetic regulation of rejection and survival following human lung transplantation by the innate immune receptor CD14.
17207357 2007 [Association between cluster of differentiation 14 polymorphism and susceptibility of infection].
17205552 2007 Identification of soluble CD14 as an endogenous agonist for Toll-like receptor 2 on human astrocytes by genome-scale functional screening of glial cell derived proteins.
17201240 2006 Diisocyanate asthma and gene-environment interactions with IL4RA, CD-14, and IL-13 genes.
17196641 2007 TNF-alpha (-308 G/A) and CD14 (-159T/C) polymorphisms in the bronchial responsiveness of Korean children with asthma.
17187267 2007 Is the CD14 C159T polymorphism effective in the development of secondary amyloidosis in Familial Mediterranean fever?
17126402 2007 Phosphatidyl inositol-3-phosphate kinase mediates CD14 dependent signaling.
17098305 2007 CD14 C (-260)T polymorphism, atherosclerosis, elderly: role of cytokines and metallothioneins.
17087609 2007 Post-hoc analysis on the CD14 C(-260)T promoter polymorphism and coronary heart disease.
17086894 Functional polymorphisms of CD14 and toll-like receptor 4 in Taiwanese Chinese with Helicobacter pylori-related gastric malignancies.
17075287 2006 Failure to find an association between CD14-159C/T polymorphism and asthma: a family-based association test and meta-analysis.
17067484 2006 [The influence of CD14 genomic polymorphism on CD14 gene expression as well as protein release and its clinical significance in patients with extensive burns].
17062130 2006 Polymorphisms within inflammatory genes and colorectal cancer.
17056323 2006 Influence of the CD14 C260T promoter polymorphism on C-reactive protein levels in patients with coronary artery disease.
17052752 Distribution of CD14+ and CD68+ macrophages in the placental bed and basal plate of women with preeclampsia and preterm labor.
17046070 2006 Increased serum levels of soluble CD14 indicate stable multiple sclerosis.
17030237 2006 Gene-environment interactions with CD14 C-260T and their relationship to total serum IgE levels in adults.
17007028 2006 Association of promoter polymorphism of the CD14 C (-159) T endotoxin receptor gene with chronic hepatitis B.
17003960 2006 Polymorphisms of the CD14 gene and atopic phenotypes in Czech patients with IgE-mediated allergy.
16950521 2006 Polymorphism of the CD14 gene in perennial allergic rhinitis.
16950285 2006 Association between farm exposure and atopy, according to the CD14 C-159T polymorphism.
16933467 2006 CARD15/NOD2, CD14, and toll-like receptor 4 gene polymorphisms in Greek patients with sarcoidosis.
16916546 2006 Investigating disease susceptibility and the negative correlation of schizophrenia and rheumatoid arthritis focusing on MIF and CD14 gene polymorphisms.
16893989 2006 Association of CD14 promoter polymorphism with otitis media and pneumococcal vaccine responses.
16890863 2006 Synergistic effect of Toll-like receptor 4 and CD14 polymorphisms on the total atherosclerosis burden in patients with peripheral arterial disease.
16880211 2006 Membrane sorting of toll-like receptor (TLR)-2/6 and TLR2/1 heterodimers at the cell surface determines heterotypic associations with CD36 and intracellular targeting.
16879054 2006 Polymorphisms of the inflammatory system and risk of ischemic cerebrovascular events.
16873708 2006 Genetic and acquired inflammatory conditions are synergistically associated with early carotid atherosclerosis.
16860318 2006 LPS/CD14 activation triggers SGLT-1-mediated glucose uptake and cell rescue in intestinal epithelial cells via early apoptotic signals upstream of caspase-3.
16848791 2006 CD14 directly binds to triacylated lipopeptides and facilitates recognition of the lipopeptides by the receptor complex of Toll-like receptors 2 and 1 without binding to the complex.
16836908 2006 [Expression of lipopolysaccharides signal receptors CD14 and TLR4 in human dental pulp tissue and fibroblasts].
16815140 2006 Polymorphisms in the novel gene acyloxyacyl hydroxylase (AOAH) are associated with asthma and associated phenotypes.
16785528 2006 Analysis of TLR4 polymorphic variants: new insights into TLR4/MD-2/CD14 stoichiometry, structure, and signaling.
16751411 2006 The envelope protein of a human endogenous retrovirus-W family activates innate immunity through CD14/TLR4 and promotes Th1-like responses.
16749413 CD14 receptor gene promoter polymorphism: awakening maternal immunity during pregnancy.
16706818 2006 Polymorphism of CD14 gene but not the mutation of TLR4 gene is associated with colorectal cancer in Chinese patients.
16698680 2006 Polymorphism in the promoter region of the CD14 gene and susceptibility to Brucellosis.
16625214 2006 Multifactor dimensionality reduction reveals gene-gene interactions associated with multiple sclerosis susceptibility in African Americans.
16614348 2006 Endotoxin exposure, CD14, and allergic disease: an interaction between genes and the environment.
16611358 2006 IL-10, IL-6 and CD14 polymorphisms and sepsis outcome in ventilated very low birth weight infants.
16552356 2006 The effect of ciprofloxacin on CD14 and toll-like receptor-4 expression on human monocytes.
16538169 2006 CD14 promoter polymorphisms have no functional significance and are not associated with atopic phenotypes.
16520888 2006 ALDH2 polymorphisms and bone mineral density in an elderly Japanese population.
16512634 2006 [Clinical study of serum lipopolysaccharide-binding protein and soluble CD14 in severe sepsis patients].
16509825 2006 Effect of CD14 -260C>T polymorphism on the mortality of critically ill patients.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16492974 2006 Killing the messenger in the nick of time: persistence of breast milk sCD14 in the neonatal gastrointestinal tract.
16473828 2006 Double-stranded RNA-mediated TLR3 activation is enhanced by CD14.
16467036 Lack of association of the CD14/C-159T polymorphism with susceptibility and serological activity parameters of rheumatoid arthritis.
16446545 2006 CD14 promoter polymorphisms in atopic families: implications for modulated allergen-specific immunoglobulin E and G1 responses.
16444757 2006 A CD14 domain with lipopolysaccharide-binding and -neutralizing activity.
16443672 2006 GPI-linked endothelial CD14 contributes to the detection of LPS.
16437636 2005 Combined carriership of TLR9-1237C and CD14-260T alleles enhances the risk of developing chronic relapsing pouchitis.
16433727 2006 Gene by environment interaction: the -159C/T polymorphism in the promoter region of the CD14 gene modifies the effect of alcohol consumption on serum IgE levels.
16427140 2006 Association of a maternal CD14 -159 gene polymorphism with preterm premature rupture of membranes and spontaneous preterm birth in multi-fetal pregnancies.
16409569 2006 Common promoter polymorphism in monocyte differentiation antigen CD14 is associated with serum triglyceride levels and body mass index in non-diabetic individuals.
16387800 2006 Acute asthma in children: Relationships among CD14 and CC16 genotypes, plasma levels, and severity.
16386288 2006 Helicobacter pylori infection and the CD14 C(-260)T gene polymorphism in ischemic stroke.
16385250 2006 Genetic polymorphisms of CD14, toll-like receptor 4, and caspase-recruitment domain 15 are not associated with necrotizing enterocolitis in very low birth weight infants.
16381901 2006 The LIFEdb database in 2006.
16368002 2005 The CD14 functional gene polymorphism -260 C>T is not involved in either the susceptibility to Chlamydia trachomatis infection or the development of tubal pathology.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16337421 2006 A CD14 monocyte receptor polymorphism and genetic susceptibility to Parkinson's disease for females.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16331574 2005 [Association of C-159T polymorphism in promoter region of CD14 and coronary heart disease].
16292464 2006 Association of CD14 promoter polymorphisms and soluble CD14 levels in mite allergen sensitization of children in Taiwan.
16290232 Association between levels of Toll-like receptors 2 and 4 and CD14 mRNA and allergy in pregnant women and their offspring.
16283111 2005 Peripheral blood phagocyte CD14 and CD11b expression on admission to hospital in relation to mortality among patients with community-acquired infection.
16275943 2005 Comparison of lipopolysaccharide-binding functions of CD14 and MD-2.
16273622 2005 CD14 promoter polymorphism in Chinese alcoholic patients with cirrhosis of liver and acute pancreatitis.
16273620 2005 Different effects of a CD14 gene polymorphism on disease outcome in patients with alcoholic liver disease and chronic hepatitis C infection.
16266379 2005 The effect of polymorphisms at the CD14 promoter and the TLR4 gene on asthma phenotypes in Turkish children with asthma.
16246938 2005 CD14 and TLR4 gene polymorphisms in adult periodontitis.
16239565 2005 Peptidoglycan of Staphylococcus aureus upregulates monocyte expression of CD14, Toll-like receptor 2 (TLR2), and TLR4 in human blood: possible implications for priming of lipopolysaccharide signaling.
16194368 2005 [CD14 genomic polymorphism influences CD14 expression in whole blood culture].
16174099 2005 Polymorphisms of CARD15/NOD2 and CD14 genes in New Zealand Crohn's disease patients.
16174094 2005 Time to abandon dogma: CD14 is expressed by non-myeloid lineage cells.
16165702 2005 Polymorphism of the heat-shock protein gene Hsp70-2, but not polymorphisms of the IL-10 and CD14 genes, is associated with the outcome of Crohn's disease.
16159630 2005 Opposite effects of CD 14/-260 on serum IgE levels in children raised in different environments.
16148556 2005 Are genetic polymorphisms of tumour necrosis factor alpha, interleukin-10, CD14 endotoxin receptor or manganese superoxide dismutase associated with alcoholic liver disease?
16142747 2005 Organic dust induced inflammation--role of atopy and TLR-4 and CD14 gene polymorphisms.
16137548 2005 CD14 gene -260 C/T polymorphism is associated with chronic heart failure.
16109674 2005 A CD14 gene polymorphism is associated with the IgE level for Dermatophagoides pteronyssinus.
16101942 2005 CT genotype of promotor polymorphism C159T in the CD14 gene is associated with lower prevalence of atopic dermatitis and lower IL-13 production.
16085746 2005 Polymorphisms of CD14 gene and TLR4 gene are not associated with ulcerative colitis in Chinese patients.
16061600 2005 Promoter polymorphism of the CD14 endotoxin receptor gene is associated with biliary atresia and idiopathic neonatal cholestasis.
16051275 2005 Influence of toll-like receptor 4, CD14, tumor necrosis factor, and interleukine-10 gene polymorphisms on clinical outcome in Japanese critically ill patients.
16046876 2005 The -159C/T polymorphism in the promoter region of the CD14 gene is associated with advanced liver disease and higher serum levels of acute-phase proteins in heavy drinkers.
16038043 2005 Association of polymorphisms of IL and CD14 genes with acute severe pancreatitis and septic shock.
15975149 2005 CD14 C-159T and early infection with Pseudomonas aeruginosa in children with cystic fibrosis.
15966209 CD14 expression on monocytes and soluble CD14 plasma levels in correlation to the promotor polymorphism of the endotoxin receptor CD14 gene in patients with inactive Crohn's disease.
15946916 2005 Association between the promoter polymorphism T/C at position -159 of the CD14 gene and anti-inflammatory therapy in patients with inflammatory bowel disease.
15940135 2005 Evaluation of the CD14/-260 polymorphism and house dust endotoxin exposure in the Barbados Asthma Genetics Study.
15932345 2005 Interaction of SP-A (surfactant protein A) with bacterial rough lipopolysaccharide (Re-LPS), and effects of SP-A on the binding of Re-LPS to CD14 and LPS-binding protein.
15879416 2005 CD14 tobacco gene-environment interaction modifies asthma severity and immunoglobulin E levels in Latinos with asthma.
15867866 2005 Polymorphisms in the 5' region of the CD14 gene are associated with eczema in young children.
15854776 2005 CD14 receptor polymorphism and Alzheimer's disease risk.
15842262 2005 Association of the -159 CD14 gene polymorphism and lack of association of the -308 TNFA and Q551R IL-4RA polymorphisms with severe chronic periodontitis in Swedish Caucasians.
15778383 2005 Cross-talk between CD14 and complement receptor 3 promotes phagocytosis of mycobacteria: regulation by phosphatidylinositol 3-kinase and cytohesin-1.
15777548 2005 Interaction between the C-260T polymorphism of the CD14 gene and the plasma IL-6 concentration on the risk of myocardial infarction: the HIFMECH study.
15764151 2005 Lack of association of the CD14 promoter polymorphism--159C/T with Caucasian inflammatory bowel disease.
15753758 2005 Polymorphisms in CD14, mannose-binding lectin, and Toll-like receptor-2 are associated with increased prevalence of infection in critically ill adults.
15741437 2005 The CD14 C-159T polymorphism is not associated with asthma or asthma severity in an Australian adult population.
15714129 2005 Polymorphism of the TNF-alpha, HSP70-2, and CD14 genes increases susceptibility to severe acute pancreatitis.
15686783 2005 CD14 C(-260)T promoter polymorphism and prevalence of acute coronary syndromes.
15670766 2005 The CD14 region spanning amino acids 57-64 is critical for interaction with the extracellular Toll-like receptor 2 domain.
15655821 2005 Association between polymorphisms in the Toll-like receptor 4, CD14, and CARD15/NOD2 and inflammatory bowel disease in the Greek population.
15647432 2005 No evidence for involvement of the Toll-like receptor 4 (TLR4) A896G and CD14-C260T polymorphisms in susceptibility to ankylosing spondylitis.
15640605 2005 Association of the -159C/T polymorphism of the endotoxin receptor (CD14) with carotid artery disease and cardiovascular mortality in dialysis patients.
15619435 2005 Degree of CD14 expression in melanoma infiltrating mononuclear phagocytes.
15602630 2005 Association study using combination analysis of SNP and STRP markers: CD14 promoter polymorphism and IgE level in Taiwanese asthma children.
15599151 2004 Soluble CD14 receptor expression and monocyte heterogeneity but not the C-260T CD14 genotype are associated with severe acute pancreatitis.
15591473 2005 Polymorphisms in the CD14 gene associated with pulmonary function in farmers.
15558232 2004 Monocytic expression of CD14 and CD18, circulating adhesion molecules and inflammatory markers in women with diabetes mellitus and impaired glucose tolerance.
15520404 2004 TLR4 and TNF-alpha polymorphisms are associated with an increased risk for severe sepsis following burn injury.
15516360 2004 Polymorphisms of genes involved in innate immunity: association with preterm delivery.
15491315 2004 The CD14 -159C-to-T promoter polymorphism in periodontal disease.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378299 2004 Suggestive evidence of association of C-159T functional polymorphism of the CD14 gene with atopic asthma in northern and northwestern Indian populations.
15373760 2004 The differential effect of genetic variation on soluble CD14 levels in human plasma and milk.
15369724 2004 Association of methylenetetrahydrofolate reductase T677 allele with early development of chronic allograft nephropathy.
15358661 2004 Membrane-anchored CD14 is important for induction of interleukin-8 by lipopolysaccharide and peptidoglycan in uroepithelial cells.
15356557 2004 A TLR4 polymorphism is associated with asthma and reduced lipopolysaccharide-induced interleukin-12(p70) responses in Swedish children.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15292769 2004 Promoter polymorphism of the gene for CD14 receptor is not associated with sub-clinical carotid atherosclerosis in a community population.
15273551 2004 Innate immunity genes influence the severity of acute appendicitis.
15269840 2004 CD14+CD16+ monocytes in coronary artery disease and their relationship to serum TNF-alpha levels.
15257175 2004 CD14 C(-260)T gene polymorphism, circulating soluble CD14 levels and arteriosclerosis.
15207785 2004 Polymorphisms of the lipopolysaccharide-signaling complex in inflammatory bowel disease: association of a mutation in the Toll-like receptor 4 gene with ulcerative colitis.
15190267 2004 NOD2/CARD15, TLR4 and CD14 mutations in Scottish and Irish Crohn's disease patients: evidence for genetic heterogeneity within Europe?
15175649 2004 CD14 promoter polymorphism -159C>T is associated with susceptibility to chronic Chlamydia pneumoniae infection in peripheral blood monocytes.
15166925 2004 Association of the -159C --> T polymorphism in the CD14 promoter with variations in serum lipoproteins in healthy subjects.
15164100 2004 A CD14 promoter polymorphism is associated with CD14 expression and Chlamydia-stimulated TNF alpha production.
15143473 2004 Association between common Toll-like receptor 4 mutations and severe respiratory syncytial virus disease.
15132789 2004 [Association between a genomic polymorphism within the CD14 locus and severe sepsis susceptibility as well as prognosis in patients after extensive burns].
15120158 2004 Loss of lipopolysaccharide receptor CD14 from the surface of human macrophage-like cells mediated by Porphyromonas gingivalis outer membrane vesicles.
15116260 2004 Pharmacogenetics of the CD14 endotoxin receptor polymorphism and progression of coronary atherosclerosis.
15081257 2004 Functional polymorphisms in LPS receptors CD14 and TLR4 are not associated with disease susceptibility or Campylobacter jejuni infection in Guillain-Barré patients.
15080833 2004 A promoter polymorphism in the CD14 gene is associated with elevated levels of soluble CD14 but not with IgE or atopic diseases.
15069085 2004 Dual receptors and distinct pathways mediate interleukin-1 receptor-associated kinase degradation in response to lipopolysaccharide. Involvement of CD14/TLR4, CR3, and phosphatidylinositol 3-kinase.
15039096 2004 CD14 gene promoter polymorphism in different clinical forms of tuberculosis.
15034063 2004 CD14 is an acute-phase protein.
14996480 2004 Promoter polymorphism in the CD14 gene and concentration of soluble CD14 in patients with in-stent restenosis after elective coronary stenting.
14739370 2004 Mutations of genes involved in the innate immune system as predictors of sepsis in very low birth weight infants.
14720421 2003 [The associations of the single nucleotide polymorphisms on TNF and CD14 promoters with the mortality of infection, systematic inflammatory response syndromec and sepsis in surgical patients].
14706103 2004 Ehrlichia chaffeensis downregulates surface Toll-like receptors 2/4, CD14 and transcription factors PU.1 and inhibits lipopolysaccharide activation of NF-kappa B, ERK 1/2 and p38 MAPK in host monocytes.
14673018 2004 Highly purified lipoteichoic acid activates neutrophil granulocytes and delays their spontaneous apoptosis via CD14 and TLR2.
14672339 2003 Searching for links between endotoxin exposure and pregnancy loss: CD14 polymorphism in idiopathic recurrent miscarriage.
14648231 2003 The C(-260)>T gene polymorphism in the promoter of the CD14 monocyte receptor gene is not associated with acute myocardial infarction.
14624155 2003 Effect of the CD14 promoter polymorphism on liver function tests and its association with alcohol and obesity.
14617510 2004 Age-specific relationship between CD14 and atopy in a cohort assessed from age 8 to 25 years.
14587643 2003 Association study of CD14 polymorphism with myocardial infarction in a Japanese population.
14517520 2003 A polymorphism in the promoter of the CD14 gene (CD14/-159) is associated with the development of coronary artery lesions in patients with Kawasaki disease.
14517492 2003 Association of the -159 C --> T polymorphism in the CD14 promoter with variations in serum lipoproteins in healthy subjects.
14510720 2003 Two CD14 promoter polymorphisms and atopic phenotypes in Czech patients with IgE-mediated allergy.
14508193 2003 Soluble CD14 and aortic stiffness in a population-based study.
14500479 2003 Augmentation of Actinobacillus actinomycetemcomitans invasion of human oral epithelial cells and up-regulation of interleukin-8 production by saliva CD14.
12960274 2003 Human circulating CD14+ monocytes as a source of progenitors that exhibit mesenchymal cell differentiation.
12942028 2003 Expression and involvement of Toll-like receptors (TLR)2, TLR4, and CD14 in monocyte TNF-alpha production induced by lipopolysaccharides from Neisseria meningitidis.
12940436 2003 Interaction of polymorphisms in the CARD15 and CD14 genes in patients with Crohn disease.
12938192 2003 Soluble CD14 levels are increased and inversely correlated with the levels of hepatitis B surface antigen in chronic hepatitis B patients.
12911501 2003 The C-159T polymorphism in the CD14 promoter is associated with serum total IgE concentration in atopic Chinese children.
12897754 2003 The -159 C-->T polymorphism of CD14 is associated with nonatopic asthma and food allergy.
12885845 2003 Single-nucleotide polymorphism in the CD14 promoter and periodontal disease expression in a Japanese population.
12853157 2003 Antibody to CD14 like CXCR4-specific antibody 12G5 could inhibit CXCR4-dependent chemotaxis and HIV Env-mediated cell fusion.
12832426 2003 Toll-like receptor 4 and CD14 mRNA expression are lower in resistive exercise-trained elderly women.
12825176 2003 Association of CD14 promoter gene polymorphism and Chlamydia pneumoniae infection.
12757265 2003 Treatment with an anti-CD14 monoclonal antibody delays and inhibits lipopolysaccharide-induced gene expression in humans in vivo.
12756848 2003 [CD14 (C-159-->T) polymorphism and levels of C-reactive protein].
12754215 2003 Lipopolysaccharide (LPS)-binding protein inhibits responses to cell-bound LPS.
12731067 2003 CD55/decay accelerating factor is part of the lipopolysaccharide-induced receptor complex.
12700637 2003 CD14-dependent clearance of apoptotic cells by human macrophages: the role of phosphatidylserine.
12679473 2003 CD14 monocyte receptor, involved in the inflammatory cascade, and insulin sensitivity.
12663765 2003 Human cytomegalovirus activates inflammatory cytokine responses via CD14 and Toll-like receptor 2.
12624278 2003 Promoter polymorphism in the endotoxin receptor (CD14) is associated with increased carotid atherosclerosis only in smokers: the Carotid Atherosclerosis Progression Study (CAPS).
12594207 2003 Lipoteichoic acid (LTA) of Streptococcus pneumoniae and Staphylococcus aureus activates immune cells via Toll-like receptor (TLR)-2, lipopolysaccharide-binding protein (LBP), and CD14, whereas TLR-4 and MD-2 are not involved.
12580907 2003 Evaluation of the CD14 C-159 T polymorphism in the German Multicenter Allergy Study cohort.
12566518 2003 Association of the CD14 gene -159C polymorphism with progression of IgA nephropathy.
12492251 2002 CD14 and TNfa promoter polymorphisms in patients with acute arthritis. Special reference to development of chronic spondyloarthropathy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450609 2002 C(-260)T polymorphism in the promoter of the CD14 gene is not associated with coronary artery disease and myocardial infarction in the Ludwigshafen Risk and Cardiovascular Health (LURIC) study.
12438323 2002 Induction of keratinocyte growth factor 1 Expression by lipopolysaccharide is regulated by CD-14 and toll-like receptors 2 and 4.
12417309 2002 Evidence of a trimolecular complex involving LPS, LPS binding protein and soluble CD14 as an effector of LPS response.
12410798 2002 CD14-mediated induction of interleukin-8 and monocyte chemoattractant protein-1 by a heat-resistant constituent of Porphyromonas gingivalis in endothelial cells.
12404174 2002 Human toll-like receptor 4 mutations but not CD14 polymorphisms are associated with an increased risk of gram-negative infections.
12324469 2002 Lipopolysaccharide rapidly traffics to and from the Golgi apparatus with the toll-like receptor 4-MD-2-CD14 complex in a process that is distinct from the initiation of signal transduction.
12207338 2002 Bacterial fimbriae activate human peripheral blood monocytes utilizing TLR2, CD14 and CD11a/CD18 as cellular receptors.
12196527 2002 Regions of the mouse CD14 molecule required for toll-like receptor 2- and 4-mediated activation of NF-kappa B.
12185442 2002 The -260 C-->T promoter polymorphism of the lipopolysaccharide receptor CD14 and severe sepsis in trauma patients.
12174084 2002 TLR4-dependent recognition of lipopolysaccharide by epithelial cells requires sCD14.
12171914 2002 Toll-like receptor (TLR) signaling in response to Aspergillus fumigatus.
12140663 2002 Lipopolysaccharide receptor CD14 polymorphism and risk of stroke in a South-German population.
12126249 2002 Ulcerative colitis is associated with a promoter polymorphism of lipopolysaccharide receptor gene, CD14.
12117913 2002 Lipopolysaccharide-binding protein- and CD14-dependent activation of mitogen-activated protein kinase p38 by lipopolysaccharide in human neutrophils is associated with priming of respiratory burst.
12106839 2002 Significance of peptidoglycan, a proinflammatory bacterial antigen in atherosclerotic arteries and its association with vulnerable plaques.
12103253 2002 CD14 C(-260)-->T polymorphism, plasma levels of the soluble endotoxin receptor CD14, their association with chronic infections and risk of stable coronary artery disease.
12101079 The CD14-260 C --> T promoter polymorphism co-segregates with the tumor necrosis factor-alpha (TNF-alpha)-308 G --> A polymorphism and is associated with the interleukin-1 beta (IL-1 beta) synthesis capacity of human leukocytes.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12075251 2002 CD14 gene -159C/T polymorphism is not associated with coronary artery disease and myocardial infarction.
12067299 2002 Human proteinase 3 can inhibits LPS-mediated TNF-alpha production through CD14 degradation: lack of influence of antineutrophil cytoplasmic antibodies.
12011764 2002 Is the CD14 receptor gene a marker for smoking dependence?
12006789 2002 Association between a genomic polymorphism within the CD14 locus and septic shock susceptibility and mortality rate.
11985523 2002 Effect of CD14 promoter polymorphism and H. pylori infection and its clinical outcomes on circulating CD14.
11935032 2002 A prospective evaluation of the CD14 and CD18 gene polymorphisms and risk of stroke.
11932927 2002 Non-LPS components of Chlamydia pneumoniae stimulate cytokine production through Toll-like receptor 2-dependent pathways.
11854210 2002 Human gingival CD14(+) fibroblasts primed with gamma interferon increase production of interleukin-8 in response to lipopolysaccharide through up-regulation of membrane CD14 and MyD88 mRNA expression.
11843056 2002 A polymorphism in the CD14 gene is associated with Crohn disease.
11841490 2002 Promoter region polymorphism of the CD14 gene (C-159T) is not associated with psoriasis vulgaris.
11825494 1998 [The significance of changes in serum soluble lipopolysaccharide receptor CD14 levels in burned patients with multiple organ dysfunction syndrome].
11810121 2001 Lack of association between the -260 C-->T promoter polymorphism of the endotoxin receptor CD14 gene and the CD14 density of unstimulated human monocytes and soluble CD14 plasma levels.
11779220 2002 CD14-dependent activation of NF-kappaB by filarial parasitic sheath proteins.
11745332 2001 Lipopolysaccharide and ceramide docking to CD14 provokes ligand-specific receptor clustering in rafts.
11732288 2001 [Molecular studies in a population of children with bronchial asthma. I. Polymorphism in the promotor region of gene CD14].
11489942 2001 Plasma CD14 decreases monocyte responses to LPS by transferring cell-bound LPS to plasma lipoproteins.
11343243 2001 Promoter polymorphism of the CD14 endotoxin receptor gene as a risk factor for alcoholic liver disease.
11282774 2001 Association of a promoter polymorphism of the CD14 gene and atopy.
11274165 2001 Lipopolysaccharide is in close proximity to each of the proteins in its membrane receptor complex. transfer from CD14 to TLR4 and MD-2.
11257272 2001 A prospective evaluation of the CD14 C(-260)T gene polymorphism and the risk of myocardial infarction.
11199329 2000 A prospective study of genetic markers of susceptibility to infection and inflammation, and the severity, progression, and regression of coronary atherosclerosis and its response to therapy.
11145656 2001 Soluble CD14 mediates efflux of phospholipids from cells.
11083760 2000 Human lactoferrin interacts with soluble CD14 and inhibits expression of endothelial adhesion molecules, E-selectin and ICAM-1, induced by the CD14-lipopolysaccharide complex.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11062291 2000 Polymorphism in the promoter of lipopolysaccharide receptor CD14 and ischemic cerebrovascular disease.
10575214 1999 High resolution physical mapping of human HDAC3, a potential tumor suppressor gene in the 5q31 region.
10395652 1999 Signaling events induced by lipopolysaccharide-activated toll-like receptor 2.
9665271 1998 LPS-binding proteins and receptors.
9655682 1998 LPS receptor CD14 participates in release of TNF-alpha in RAW 264.7 and peritoneal cells but not in kupffer cells.
9562334 1998 Interferon-gamma (IFN-gamma) and tumor necrosis factor-alpha (TNF-alpha) enhance lipopolysaccharide binding to neutrophils via CD14.
9548256 1998 Human CD14 mediates recognition and phagocytosis of apoptotic cells.
9142045 1997 Beta 2 (CD11/CD18) integrins can serve as signaling partners for other leukocyte receptors.
8798531 1996 CD14 is a cell-activating receptor for bacterial peptidoglycan.
8612135 1996 Resistance to endotoxin shock and reduced dissemination of gram-negative bacteria in CD14-deficient mice.
7583357 1995 LPS-dependent interaction of Mac-2-binding protein with immobilized CD14.
3385210 1988 The monocyte differentiation antigen, CD14, is anchored to the cell membrane by a phosphatidylinositol linkage.
2779588 1989 Structural relationship between the soluble and membrane-bound forms of human monocyte surface glycoprotein CD14.
2472171 1989 Mouse and human CD14 (myeloid cell-specific leucine-rich glycoprotein) primary structure deduced from cDNA clones.
2462937 1989 Monocyte antigen CD14 is a phospholipid anchored membrane protein.
2453848 1988 Nucleotide sequence of the gene encoding the monocyte differentiation antigen, CD14.
2448876 1988 The CD14 monocyte differentiation antigen maps to a region encoding growth factors and receptors.
2402637 1990 Structure and function of lipopolysaccharide binding protein.
1698311 1990 CD14, a receptor for complexes of lipopolysaccharide (LPS) and LPS binding protein.