Property Summary

NCBI Gene PubMed Count 694
PubMed Score 109.59
PubTator Score 2951.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Juvenile arthritis 126
Schizophrenia 1160
Disease Target Count Z-score Confidence
Paroxysmal nocturnal hemoglobinuria 10 3.285 1.6

Expression

 CSPA Cell Line (2)

Protein-protein Interaction (11)

Gene RIF (756)

AA Sequence

MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFL      1 - 70
KRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEAT     71 - 140
GLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGER    141 - 210
GLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNS    211 - 280
LNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVP    281 - 350
ACARSTLSVGVSGTLVLLQGARGFA                                                 351 - 375
//

Text Mined References (699)

PMID Year Title