Property Summary

Ligand Count 93
NCBI Gene PubMed Count 19
PubMed Score 18.92
PubTator Score 100.50

Knowledge Summary

Patent (50,713)

Expression

  Differential Expression (11)

Disease log2 FC p
cutaneous lupus erythematosus 2.600 1.4e-04
intraductal papillary-mucinous adenoma (... 1.500 1.4e-03
intraductal papillary-mucinous carcinoma... 1.400 3.5e-03
lung adenocarcinoma -1.203 9.3e-07
lung cancer -2.400 1.1e-02
lung carcinoma -1.700 3.0e-19
malignant mesothelioma -1.800 4.2e-07
mucosa-associated lymphoid tissue lympho... 1.012 1.7e-02
non-small cell lung cancer -1.883 5.3e-18
osteosarcoma -3.257 3.5e-05
tuberculosis -4.000 1.2e-08

Protein-protein Interaction (5)

Gene RIF (11)

AA Sequence

MANYTLAPEDEYDVLIEGELESDEAEQCDKYDAQALSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLK      1 - 70
RVENIYLLNLAVSNLCFLLTLPFWAHAGGDPMCKILIGLYFVGLYSETFFNCLLTVQRYLVFLHKGNFFS     71 - 140
ARRRVPCGIITSVLAWVTAILATLPEFVVYKPQMEDQKYKCAFSRTPFLPADETFWKHFLTLKMNISVLV    141 - 210
LPLFIFTFLYVQMRKTLRFREQRYSLFKLVFAIMVVFLLMWAPYNIAFFLSTFKEHFSLSDCKSSYNLDK    211 - 280
SVHITKLIATTHCCINPLLYAFLDGTFSKYLCRCFHLRSNTPLQPRGQSAQGTSREEPDHSTEV          281 - 344
//

Text Mined References (22)

PMID Year Title