Property Summary

NCBI Gene PubMed Count 40
PubMed Score 25.50
PubTator Score 27.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.600 3.0e-02
oligodendroglioma -1.500 5.0e-02
osteosarcoma -1.444 3.9e-03
atypical teratoid / rhabdoid tumor -1.200 3.3e-03
glioblastoma -1.300 3.2e-05
Breast cancer 3.000 2.4e-02
adult high grade glioma -1.300 7.6e-03
pilocytic astrocytoma -1.200 5.0e-05
posterior fossa group A ependymoma -1.100 1.3e-05
subependymal giant cell astrocytoma -1.687 4.8e-02
ovarian cancer -1.100 2.3e-05
pituitary cancer -1.700 2.3e-04

Gene RIF (17)

PMID Text
26487539 We demonstrated that restoration of CP110 expression in MDA-MB-231 and MCF-7 cells by miR-129 overexpression rendered the cells sensitive to docetaxel.
26304236 Data show thata combining cyclin-dependent kinase 2 (CDK2) antagonism and ubiquitin thioesterase 33 (USP33) depletion augments anaphase catastrophe via changes in centrosomal protein of 110 kDa (CP110) protein expression.
25808870 CP110 plays a mechanistic role in response of lung cancer cells to CDK2 inhibition, especially in the presence of activated KRAS mutations.
25753040 Centrin2 regulates primary ciliogenesis through controlling CP110 levels.
25201258 Both protein and mRNA levels of ciliogenesis-associated markers CP110, Foxj1, TAp73 were significantly increased in patients with nasal polyps versus those seen in control subjects and were positively correlated with cilia length
23486064 using human cells, identification of a new mechanism for the regulation of centrosome duplication that requires USP33, a deubiquitinating enzyme that is able to regulate CP110 levels
22684256 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
22441691 Neurl4 counteracts accumulation of CP110, thereby maintaining normal centriolar homeostasis and preventing formation of ectopic microtubular organizing centres
21982113 Cp110 expression in mucosa from patients with chronic rhinosinusitis might contribute to the poor ciliation observed in these patients
21620453 Study found that loss of Kif24 leads to the disappearance of CP110 from mother centrioles in cycling cells able to form cilia; thus, identifying a centriolar kinesin that specifically remodels a subset of microtubules, thereby regulating cilia assembly.
20596027 SCF(Cyclin F)-mediated degradation of CP110 is required for the fidelity of mitosis and genome integrity
19481458 Results suggest that CPAP and CP110 play antagonistic roles in determining the extent of tubulin addition during centriole elongation, thereby controlling the length of newly formed centrioles.
18694559 These results suggest that CEP290 cooperates with Rab8a to promote ciliogenesis and that this function is antagonized by CP110.
17765674 The transition from centrioles to basal bodies is negatively regulated by CP11 protein.
17719545 CP110 suppresses a cilia assembly program.
16760425 These data demonstrate a functional role for CaM binding to CP110 and suggest that CP110 cooperates with CaM and centrin to regulate progression through cytokinesis.
12361598 CP110, a cell cycle-dependent CDK substrate, regulates centrosome duplication (CP110)

AA Sequence

MEEYEKFCEKSLARIQEASLSTESFLPAQSESISLIRFHGVAILSPLLNIEKRKEMQQEKQKALDVEARK      1 - 70
QVNRKKALLTRVQEILDNVQVRKAPNASDFDQWEMETVYSNSEVRNLNVPATFPNSFPSHTEHSTAAKLD     71 - 140
KIAGILPLDNEDQCKTDGIDLARDSEGFNSPKQCDSSNISHVENEAFPKTSSATPQETLISDGPFSVNEQ    141 - 210
QDLPLLAEVIPDPYVMSLQNLMKKSKEYIEREQSRRSLRGSINRIVNESHLDKEHDAVEVADCVKEKGQL    211 - 280
TGKHCVSVIPDKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTE    281 - 350
NNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGKEQAMDLIIQDTDENTN    351 - 420
VPEIMPKLPTDLAGVCSSKVYVGKNTSEVKEDVVLGKSNQVCQSSGNHLENKVTHGLVTVEGQLTSDERG    421 - 490
AHIMNSTCAAMPKLHEPYASSQCIASPNFGTVSGLKPASMLEKNCSLQTELNKSYDVKNPSPLLMQNQNT    491 - 560
RQQMDTPMVSCGNEQFLDNSFEKVKRRLDLDIDGLQKENCPYVITSGITEQERQHLPEKRYPKGSGFVNK    561 - 630
NKMLGTSSKESEELLKSKMLAFEEMRKRLEEQHAQQLSLLIAEQEREQERLQKEIEEQEKMLKEKKAMTA    631 - 700
EASELDINNAVELEWRKISDSSLLETMLSQADSLHTSNSNSSGFTNSAMQYSFVSANEAPFYLWGSSTSG    701 - 770
LTKLSVTRPFGRAKTRWSQVFSLEIQAKFNKITAVAKGFLTRRLMQTDKLKQLRQTVKDTMEFIRSFQSE    771 - 840
APLKRGIVSAQDASLQERVLAQLRAALYGIHDIFFVMDAAERMSILHHDREVRKEKMLRQMDKMKSPRVA    841 - 910
LSAATQKSLDRKKYMKAAEMGMPNKKFLVKQNPSETRVLQPNQGQNAPVHRLLSRQGTPKTSVKGVVQNR    911 - 980
QKPSQSRVPNRVPVSGVYAGKIQRKRPNVATI                                          981 - 1012
//

Text Mined References (47)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26487539 2015 MiR-129-3p promotes docetaxel resistance of breast cancer cells via CP110 inhibition.
26304236 2015 Specific CP110 Phosphorylation Sites Mediate Anaphase Catastrophe after CDK2 Inhibition: Evidence for Cooperation with USP33 Knockdown.
25808870 2015 CDK2 Inhibition Causes Anaphase Catastrophe in Lung Cancer through the Centrosomal Protein CP110.
25753040 2015 Centrin2 regulates CP110 removal in primary cilium formation.
25201258 2014 Impairment of cilia architecture and ciliogenesis in hyperplastic nasal epithelium from nasal polyps.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23486064 2013 USP33 regulates centrosome biogenesis via deubiquitination of the centriolar protein CP110.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22885064 2012 A Proteome-wide screen for mammalian SxIP motif-containing microtubule plus-end tracking proteins.
22684256 2012 miR-129-3p controls cilia assembly by regulating CP110 and actin dynamics.
22632967 2012 Cyclin F-mediated degradation of ribonucleotide reductase M2 controls genome integrity and DNA repair.
22441691 2012 Neurl4, a novel daughter centriole protein, prevents formation of ectopic microtubule organizing centres.
22261722 2012 Interaction proteomics identify NEURL4 and the HECT E3 ligase HERC2 as novel modulators of centrosome architecture.
21982113 2011 Inflammation-mediated upregulation of centrosomal protein 110, a negative modulator of ciliogenesis, in patients with chronic rhinosinusitis.
21620453 2011 Centriolar kinesin Kif24 interacts with CP110 to remodel microtubules and regulate ciliogenesis.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20596027 2010 SCF(Cyclin F) controls centrosome homeostasis and mitotic fidelity through CP110 degradation.
19481458 2009 Control of centriole length by CPAP and CP110.
19460342 2009 Cep76, a centrosomal protein that specifically restrains centriole reduplication.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18694559 2008 CP110 suppresses primary cilia formation through its interaction with CEP290, a protein deficient in human ciliary disease.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17765674 2007 Centrioles want to move out and make cilia.
17719545 2007 Cep97 and CP110 suppress a cilia assembly program.
17681131 2007 Plk4-induced centriole biogenesis in human cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16760425 2006 CP110 cooperates with two calcium-binding proteins to regulate cytokinesis and genome stability.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275750 2005 Centrobin: a novel daughter centriole-associated protein that is required for centriole duplication.
16244668 2005 The Polo kinase Plk4 functions in centriole duplication.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12361598 2002 CP110, a cell cycle-dependent CDK substrate, regulates centrosome duplication in human cells.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.