Property Summary

NCBI Gene PubMed Count 29
PubMed Score 8.87
PubTator Score 13.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9


  Differential Expression (6)

Disease log2 FC p
acute myeloid leukemia 1.200 3.9e-02
dermatomyositis 1.100 4.7e-04
group 4 medulloblastoma 1.100 5.4e-03
ovarian cancer -1.400 9.8e-05
Pick disease -1.300 2.7e-04
progressive supranuclear palsy -1.100 4.8e-02

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (14)

AA Sequence

HEYSTSSQHMDYKDTFDMLDSLLSAQGMNM                                            701 - 730

Text Mined References (39)

PMID Year Title