Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.54
PubTator Score 14.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Familial temporal lobe epilepsy 3 1 4.558 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
lung cancer -1.900 3.4e-05
Multiple myeloma 2.050 9.6e-05
ovarian cancer -2.100 3.1e-06
subependymal giant cell astrocytoma -1.916 3.1e-02
Waldenstrons macroglobulinemia 1.443 3.5e-03

Synonym

Accession Q14094 B2R6M0 B7Z6X4
Symbols CYI
CYC1
CCNI1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MKFPGPLENQRLSFLLEKAITREAQMWKVNVRKMPSNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALAS      1 - 70
SLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNW     71 - 140
DLHTATPLDFLHIFHAIAVSTRPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFRGSMLALAMVSLE    141 - 210
MEKLIPDWLSLTIELLQKAQMDSSQLIHCRELVAHHLSTLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLH    211 - 280
PSSVPGPDFSKDNSKPEVPVRGTAAFYHHLPAASGCKQTSTKRKVEEMEVDDFYDGIKRLYNEDNVSENV    281 - 350
GSVCGTDLSRQEGHASPCPPLQPVSVM                                               351 - 377
//

Text Mined References (10)

PMID Year Title