Property Summary

NCBI Gene PubMed Count 110
PubMed Score 89.79
PubTator Score 78.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.097 1.6e-03
tuberculosis -1.500 1.0e-05
lung cancer -1.500 4.1e-04
diabetes mellitus -1.100 2.0e-03
Pick disease -1.200 4.5e-03
ovarian cancer 1.400 9.8e-04

Gene RIF (51)

PMID Text
25820824 Our results indicated that CCNH/CDK7-CtBP2 axis may augment ESCC cell migration, and targeting the interaction of both may provide a novel therapeutic target of esophageal squamous cell carcinoma .
24855060 Hemodynamic forces modulate EC proliferative phenotype through the miR-23b/CAK/cyclin H pathway.
24351404 SNPs in CCNH and ABCG2 can modulate the development of severe oxaliplatin-induced peripheral neuropathy.
23982724 When considering all thyroid cancer (DTC) cases, only rs2230641 (CCNH) was associated with DTC risk.
23456497 CCNH and CDK7 may play an important role in the tumorigenesis and development of esophageal squamous cell carcinoma.
20598140 High Cyclin H is associated with gastrointestinal stromal tumours.
20522537 Observational study of gene-disease association. (HuGE Navigator)
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19536092 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19270000 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19116388 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18950027 The expression of cyclin H and CDK7 protein in proliferating hemangiomas was significantly higher than that in involuting hemangiomas and normal skin tissues.
18854777 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18708406 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18614043 TFIIH changes subunit composition in response to DNA damage. The CAK is released from the core during nucleotide excision repair (NER).
18400256 Our study demonstrates the independent prognostic value of cyclin H expression in diffuse large B-cell lymphoma and proposes its use as a prognostic marker.
17728339 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17707548 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17707548 These results suggested that genetic variants in CAK genes, Cdk7, cyclin H, MAT1, might modulate the risk of lung cancer in a gene-gene interaction mode, which consist to the biochemical interaction of corresponding proteins.
17684142 Observational study of gene-disease association. (HuGE Navigator)
17628022 Retinoic-acid-induced RAR-CAK signaling events appear to proceed intrinsically during granulocytic development of normal primitive hematopoietic cells. ALDH-governed RA availability may mediate this process by initiating RAR-CAK signaling.
17575242 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16935935 In response to ATRA, PML/RARalpha is dissociated from CAK, leading to MAT1 degradation, G1 arrest, and decreased CAK phosphorylation of PML/RARalpha
16492920 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15695176 Confocal microscopy revealed the co-localization of PKC-iota with CAK/cdk7 in both the cytoplasm and nucleus of U-373 MG glioma cells, supporting its role in cell signaling
14569024 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
12379213 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
12140753 The cyclin H/cdk7/Mat1 kinase activity is regulated by CK2 phosphorylation of cyclin H.
12049628 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
11062157 Observational study of genotype prevalence. (HuGE Navigator)
10866664 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
10639311 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
10438593 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
10082552 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
10066804 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9765201 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9651670 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9570510 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9334327 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9311822 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9184228 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9121429 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
9054383 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
8934526 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
8849451 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function
8628270 As a component of the TFIIH transcription complex, cyclin H inhibits HIV-1 Vpr cell cycle-arresting function

AA Sequence

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSV      1 - 70
FKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKAL     71 - 140
EQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPS    141 - 210
QIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERC    211 - 280
HSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL                               281 - 323
//

Text Mined References (118)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25820824 2015 Interaction with CCNH/CDK7 facilitates CtBP2 promoting esophageal squamous cell carcinoma (ESCC) metastasis via upregulating epithelial-mesenchymal transition (EMT) progression.
25416956 2014 A proteome-scale map of the human interactome network.
24855060 2014 MicroRNA-23b regulates cyclin-dependent kinase-activating kinase complex through cyclin H repression to modulate endothelial transcription and growth under flow.
24351404 2014 Pharmacogenetic predictors of severe peripheral neuropathy in colon cancer patients treated with oxaliplatin-based adjuvant chemotherapy: a GEMCAD group study.
23982724 2013 The role of CCNH Val270Ala (rs2230641) and other nucleotide excision repair polymorphisms in individual susceptibility to well-differentiated thyroid cancer.
23456497 2013 Low expression of cyclinH and cyclin-dependent kinase 7 can decrease the proliferation of human esophageal squamous cell carcinoma.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20598140 2010 Cyclin H expression is increased in GIST with very-high risk of malignancy.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19536092 2009 Explorative study to identify novel candidate genes related to oxaliplatin efficacy and toxicity using a DNA repair array.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19270000 2009 Genetic susceptibility to esophageal cancer: the role of the nucleotide excision repair pathway.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19116388 2009 A field synopsis on low-penetrance variants in DNA repair genes and cancer susceptibility.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18950027 2008 [Expression and clinical significance of cyclin H and CDK7 in human hemangiomas].
18854777 2008 Germline genetic variations in drug action pathways predict clinical outcomes in advanced lung cancer treated with platinum-based chemotherapy.
18708406 2008 Variants of DNA repair genes and the risk of biliary tract cancers and stones: a population-based study in China.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614043 2008 Nucleotide excision repair driven by the dissociation of CAK from TFIIH.
18400256 2008 Reduced or absent cyclin H expression is an independent prognostic marker for poor outcome in diffuse large B-cell lymphoma.
17728339 2007 High-order interactions among genetic polymorphisms in nucleotide excision repair pathway genes and smoking in modulating bladder cancer risk.
17707548 2007 Polymorphisms of CAK genes and risk for lung cancer: a case-control study in Chinese population.
17684142 2007 Polymorphisms in apoptosis and cell cycle control genes and risk of brain tumors in adults.
17628022 2007 Intrinsic retinoic acid receptor alpha-cyclin-dependent kinase-activating kinase signaling involves coordination of the restricted proliferation and granulocytic differentiation of human hematopoietic stem cells.
17575242 2007 Nucleotide excision repair pathway genes and oral premalignant lesions.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16935935 2006 Retinoic acid induces leukemia cell G1 arrest and transition into differentiation by inhibiting cyclin-dependent kinase-activating kinase binding and phosphorylation of PML/RARalpha.
16782892 2006 Regulated activating Thr172 phosphorylation of cyclin-dependent kinase 4(CDK4): its relationship with cyclins and CDK "inhibitors".
16492920 2006 Nucleotide excision repair gene polymorphisms and risk of advanced colorectal adenoma: XPC polymorphisms modify smoking-related risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15695176 2005 Cyclin-dependent kinase activating kinase/Cdk7 co-localizes with PKC-iota in human glioma cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15328539 2004 A uniform procedure for the purification of CDK7/CycH/MAT1, CDK8/CycC and CDK9/CycT1.
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12527756 2003 MTA1 interacts with MAT1, a cyclin-dependent kinase-activating kinase complex ring finger factor, and regulates estrogen receptor transactivation functions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
12379213 2002 Transcription factor TFIIH components enhance the GR coactivator activity but not the cell cycle-arresting activity of the human immunodeficiency virus type-1 protein Vpr.
12140753 2002 The cyclin H/cdk7/Mat1 kinase activity is regulated by CK2 phosphorylation of cyclin H.
12049628 2002 HIV-1 Tat-associated RNA polymerase C-terminal domain kinase, CDK2, phosphorylates CDK7 and stimulates Tat-mediated transcription.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11239393 2001 Defective interplay of activators and repressors with TFIH in xeroderma pigmentosum.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
11062157 2000 Identification of single nucleotide polymorphisms in human DNA repair genes.
11056214 2000 The MAT1 cyclin-dependent kinase-activating kinase (CAK) assembly/targeting factor interacts physically with the MCM7 DNA licensing factor.
10993082 2000 TFIIH is negatively regulated by cdk8-containing mediator complexes.
10973491 2000 Abnormal integrin-mediated regulation of chronic myelogenous leukemia CD34+ cell proliferation: BCR/ABL up-regulates the cyclin-dependent kinase inhibitor, p27Kip, which is relocated to the cell cytoplasm and incapable of regulating cdk2 activity.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10734072 2000 From androgen receptor to the general transcription factor TFIIH. Identification of cdk activating kinase (CAK) as an androgen receptor NH(2)-terminal associated coactivator.
10639311 2000 Cell cycle-dependent stimulation of the HIV-1 promoter by Tat-associated CAK activator.
10583946 1999 Quality control by DNA repair.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
10024882 1999 Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9840943 1998 Cyclin E2, a novel human G1 cyclin and activating partner of CDK2 and CDK3, is induced by viral oncoproteins.
9840937 1998 Regulation of CAK kinase activity by p53.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9465303 1998 Mapping of the human genes encoding cyclin H (CCNH) and the CDK-activating kinase (CAK) assembly factor MAT1 (MNAT1) to chromosome bands 5q13.3-q14 and 14q23, respectively.
9464540 1998 Interferon-induces expression of cyclin-dependent kinase-inhibitors p21WAF1 and p27Kip1 that prevent activation of cyclin-dependent kinase by CDK-activating kinase (CAK).
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9243502 1997 The cdk7-cyclin H-MAT1 complex associated with TFIIH is localized in coiled bodies.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118957 1997 The structure of cyclin H: common mode of kinase activation and specific features.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9056480 1997 Expression in Escherichia coli: purification and characterization of cyclin H, a subunit of the human general transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8836101 1996 Three-dimensional structure of human cyclin H, a positive regulator of the CDK-activating kinase.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8692841 1996 Isolation and characterization of two human transcription factor IIH (TFIIH)-related complexes: ERCC2/CAK and TFIIH.
8628270 1996 Three functional classes of transcriptional activation domain.
8617234 1996 MAT1, cdk7 and cyclin H form a kinase complex which is UV light-sensitive upon association with TFIIH.
8521818 1995 In vitro assembly of a functional human CDK7-cyclin H complex requires MAT1, a novel 36 kDa RING finger protein.
8302582 1994 Identification and chromosomal mapping of a receptor tyrosine kinase with a putative phospholipid binding sequence in its ectodomain.
8078587 1994 A cyclin associated with the CDK-activating kinase MO15.
8069918 1994 A novel cyclin associates with MO15/CDK7 to form the CDK-activating kinase.
8001136 1994 Relationship of CDK-activating kinase and RNA polymerase II CTD kinase TFIIH/TFIIK.
7936635 1994 Cloning, expression and subcellular localization of the human homolog of p40MO15 catalytic subunit of cdk-activating kinase.
7799941 1995 Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.
7629134 1995 Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.
7533895 1995 Cdk-activating kinase complex is a component of human transcription factor TFIIH.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.