Property Summary

Ligand Count 1
NCBI Gene PubMed Count 197
PubMed Score 184.45
PubTator Score 957.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
active Crohn's disease 1.006 1.2e-02
adrenocortical carcinoma 2.239 1.1e-04
adult high grade glioma 1.800 3.3e-04
Atopic dermatitis 1.700 3.1e-04
atypical teratoid / rhabdoid tumor 3.000 7.1e-10
Breast cancer 2.000 7.1e-11
breast carcinoma 1.100 1.8e-31
colon cancer 1.500 1.2e-03
cutaneous lupus erythematosus 1.400 1.7e-02
ductal carcinoma in situ 2.000 2.6e-03
Endometriosis 1.477 1.2e-02
ependymoma 1.300 3.4e-05
glioblastoma 2.300 1.1e-08
group 3 medulloblastoma 3.300 6.1e-06
interstitial cystitis 1.400 1.1e-02
intraductal papillary-mucinous carcinoma... 1.700 5.6e-04
intraductal papillary-mucinous neoplasm ... 2.200 3.5e-04
invasive ductal carcinoma 2.700 2.6e-05
lung adenocarcinoma 1.300 1.8e-09
lung cancer 3.400 4.7e-05
medulloblastoma, large-cell 3.500 4.5e-06
nasopharyngeal carcinoma 1.300 2.4e-05
non-small cell lung cancer 3.247 2.0e-32
osteosarcoma -2.221 5.0e-03
ovarian cancer 1.400 1.1e-06
pancreatic cancer 1.300 1.5e-05
primary Sjogren syndrome 1.100 3.4e-02
primitive neuroectodermal tumor 3.200 5.4e-06
psoriasis 1.500 3.8e-08
tuberculosis 1.100 5.9e-03
ulcerative colitis 1.100 2.2e-04

PDB (89)

Gene RIF (122)

AA Sequence

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR      1 - 70
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP     71 - 140
LVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM    141 - 210
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY    211 - 280
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY    281 - 350
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG    351 - 420
VSLLNPPETLNL                                                              421 - 432
//

Text Mined References (203)

PMID Year Title