Property Summary

NCBI Gene PubMed Count 184
PubMed Score 164.50
PubTator Score 957.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (31)

Disease log2 FC p
psoriasis 2.000 7.2e-156
cutaneous lupus erythematosus 1.400 1.7e-02
glioblastoma 2.800 1.5e-05
osteosarcoma -2.221 5.0e-03
posterior fossa group A ependymoma 1.500 2.1e-04
medulloblastoma 3.300 1.7e-07
atypical teratoid / rhabdoid tumor 3.000 7.1e-10
medulloblastoma, large-cell 3.500 4.5e-06
primitive neuroectodermal tumor 3.200 5.4e-06
Atopic dermatitis 2.000 1.9e-05
adrenocortical carcinoma 2.258 5.1e-05
tuberculosis 1.100 5.9e-03
non-small cell lung cancer 3.247 2.0e-32
intraductal papillary-mucinous carcinoma... 1.800 4.2e-04
intraductal papillary-mucinous neoplasm ... 2.900 3.5e-04
lung cancer 4.000 1.7e-04
colon cancer 1.500 1.2e-03
active Crohn's disease 1.006 1.2e-02
pancreatic cancer 1.300 1.5e-05
interstitial cystitis 1.400 1.1e-02
lung adenocarcinoma 1.300 1.8e-09
pediatric high grade glioma 2.400 2.8e-06
primary Sjogren syndrome 1.100 3.4e-02
nasopharyngeal carcinoma 1.300 2.4e-05
Endometriosis 1.477 1.2e-02
Breast cancer 2.100 3.9e-08
breast carcinoma 1.200 9.0e-20
ductal carcinoma in situ 2.000 2.6e-03
invasive ductal carcinoma 2.700 2.6e-05
ulcerative colitis 1.100 2.2e-04
ovarian cancer 1.400 1.1e-06

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
651681 confirmatory 0 / 0 / 45 MLPCN Dyrk1A - CDK2 selectivity Assay Measured in Biochemical System Using Plate Reader - 2124-06_Inhibitor_Dose_DryPowder_Activity_Set3

Gene RIF (114)

PMID Text
26960431 Study describes a positive feedback loop centred on cyclin A2-Cdk2 inhibition of interphase APC/C-Cdc20 to allow further cyclin A2 accumulation and mitotic entry.
26706989 On analyzing cyclin A and B1 (CCNA and CCNB1) expression, positive staining in 90% cases of PTC were observed. The study revealed a significant difference in expression of cyclins A and B1 between classic and non-classic variants of PTC.
26677902 Clioquinol suppressed cell cycle progression in the S-phase in SMMC-7721 hepatoma cells via the p21, p27-cyclin E,A/Cdk2 pathway.
26373553 PIWIL2 has a role in promoting progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression
26240284 HDAC10 regulates cyclin A2 expression by deacetylating histones near the let-7 promoter.
25615569 CCN2 is a regulator of the transition through cytokinesis during terminal erythropoiesis.
25596928 our data showed that bile acid-activated FXR stimulates miR-22-silenced CCNA2, a novel pathway for FXR to exert its protective effect in the gastrointestinal tract.
25501285 Expression of cycle marker cyclin A1 differs between benign and malignant papillary breast lesions.
25393019 Cyclin A2-binding function of pUL21a contributes to the maintenance of a cell cycle state conducive for the completion of the human cytomegalovirus (HCMV) replication cycle.
25340978 for the first time, we demonstrated that CTD induced G2/M phase arrest via the inhibition of Cdc25c and cyclin A and induced apoptosis was through death receptor (extrinsic), intrinsic (mitochondria) and ER stress pathways in A375. S2 cells.
25220500 Cyclin A2 and its associated kinase (cdk2) activity are required for optimal induction of progesterone receptor target genes in breast cancer cells.
24935000 It is concluded that non-response to everolimus is characterized by increased cdk2/cyclin A, driving RCC cells into the G2/M-phase. VPA hinders everolimus non-response by diminishing cdk2/cyclin A
24824027 cyclin A expression predicted 100% of the patients at risk for metastasis of rectal neuroendocrine tumors.
24795023 Results suggest that cyclin A2 overexpression may drive cancer by promoting AKT-dependent proliferation and survival.
24622579 CCNA2 is a biomarker for the prognosis of ER+ breast cancer and monitoring of tamoxifen efficacy
24519066 show that cyclin A is an independent prognostic factor in endometrioid adenocarcinoma
24324728 The aim of the present study was to evaluate the prognostic value of the proliferation factors mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A and Ki67, alone and in combinations.
24302728 APPOLON to be a novel regulator of mitotic CYCLIN A degradation independent of SAC.
24101496 Data indicate that the major tegument 150-kDa phosphoprotein (pp150) of human cytomegalovirus (HCMV) binds to cyclin A2 via a functional RXL/Cy motif resulting in its cyclin A2-dependent phosphorylation.
24013174 Cyclin A creates a cellular environment that promotes microtubule detachment from kinetochores in prometaphase to ensure efficient error correction and faithful chromosome segregation
23815208 level unchanged in endometrial cancer
23760262 HDAC3 regulates cyclin A stability.
23460259 We further detected that reduced level of GRK2 induced a small cell cycle arrest at G2/M phase by enhancing the expression of cyclin A
23115005 Overexpression of cyclin A2 is associated with stage I non-small cell lung cancer.
23065011 human papillomavirus E4 proteins can interact with cyclin A and cdk2, which may contribute to viral manipulation of the host cell cycle.
23028682 cyclin A-Cdk2 regulates apoptosis through a mechanism that involves Rad9phosphorylation
22745723 The study has revealed that some highly differentiated human tissues express an intron-retaining cyclin A2 mRNA that induced a G1/S block in vitro.
22718829 Human cytomegalovirus IE1/2 expression was downregulated by cyclin A2, CDK1 and CDK2.
22711989 analysis of phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7
22465120 GC box was responsible for the cyclic activity of human CKAP2 promoter through the phosphorylation of Sp1, possibly by Cyclin A/Cdk complex.
22232705 Cyclin A2 negatively controls cell motility by promoting RhoA activation, thus demonstrating a novel Cyclin A2 function in cytoskeletal rearrangements and cell migration.
21871181 NF-Y binds to CCAAT sequences in the Cyclin A promoter, as well as to those in the promoters of cell cycle G2 regulators such as CDC2, Cyclin B and CDC25C.
21858804 The current results suggested that an SNP (rs769236) at the promoter of CCNA2 may be associated significantly with increased risk of colon, liver, and lung cancers.
21813648 These data demonstrate that B55alpha acts to antagonize Cyclin A/Cdk-dependent activation of FoxM1, to ensure that FoxM1 activity is restricted to the G(2) phase of the cell cycle.
21762277 The expression of cell proliferation markers cyclin A and p27 are independent prognostic factors in patients with esophageal squamous cell carcinoma.
21472690 cyclin A was strongly associated with the expression of cyclin E in invasive ductal breast carcinoma
21464733 Low p16(Ink4a) expression, overexpression of p53, cytoplasmic p27(Kip1), and Cyclin A are predictive markers for shorter overall survival in ovarian carcinomas.
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21264543 cyclin A and cyclin B1 are useful markers in the distinction of benign and malignant thyroid tumors
21078875 Results demonstrate that interaction with Mcm7 is essential for the function of cyclin A in promoting S-phase entry.
21046779 The expression of mRNA and protein of Cyclin A in hypertrophic scar changes from high level to low level as the hypertrophic scar develops, while the expression of P21cip1 changes from low level to high level.
20857402 Homocysteine-induced differential activation of Ras/ERK and PI3K/Akt/p70S6K signaling pathways and consequent expression of cyclins A and D1 are dependent on beta1 integrin.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20733051 Data show that the N terminus of cyclin A binds directly to Cdc20 and with sufficient affinity that it can outcompete the spindle assembly checkpoint proteins.
20660152 Data suggest that cyclin A2 helps initiate mitosis, in part through its effects on cyclin B1, and that cyclins B1 and B2 are particularly critical for the maintenance of the mitotic state.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20193482 Cyclin A2 and HER2 are associated with proliferation and high recurrence, particularly when combined.
20133761 The cyclin A modular centrosomal localization signal interacts with p27(KIP1), and expression of p27(KIP1) removes cyclin A but not cyclin E from centrosomes.
20126974 cyclin A expression is inhibited by bicalutamide both in androgen-dependent and -independent cell lines
19901524 The ectopic expression of cyclin A leads to extensive gamma-H2AX focus formation, which is indicative of DNA double-strand breaks.
19864233 Aberrant expression of cyclin a correlates with morphogenesis of reed-sternberg cells in Hodgkin lymphoma.
19858290 Export was reduced by Cdk inhibition or cyclin A RNA interference, suggesting that cyclin A/Cdk complexes contribute to Wee1 export.
19822658 Results underscore the crucial role of cyclin A2-CDK2 in regulating the PLK1-SCF(beta-TrCP1)-EMI1-APC/C axis and CDC6 to trigger genome reduplication after the activity of CDK1 is suppressed.
19738611 Observational study of gene-disease association. (HuGE Navigator)
19703905 cyclin A/cdk2-dependent phosphorylation of APC affects astral microtubule attachment to the cortical surface in mitosis
19692168 Observational study of gene-disease association. (HuGE Navigator)
19684852 this is the first report that knocking down expression of one gene (Cyclin A2) switches differentiation pathways of human myeloid leukemia K562 cells
19671680 These data propose a novel mechanism by which MDM2 controls the cell cycle in normal cells and how cancer cells may escape this important safety barrier.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19614764 Cyclin B1 and cyclin A are aberrantly expressed in non-small cell lung cancer and some precursor lesions. Cyclin B1, but not cyclin A, shows some promise as a potential prognostic marker in non-small cell lung cancer.
19596857 resistance of oral squamous carcinoma to IFNgamma is not due to deficiency in STAT1-dependent signaling but from a defect in the signaling component that mediates IFNgamma-induced down-regulation of CcnA2 and Cdk2 expression
19483727 All these results indicate that cyclin A acetylation at specific lysines is crucial for cyclin A stability and also has a function in the regulation of cycA-cdk activity.
19363140 CCNA2 was upregulated in IPF patients with acute exacerbation
19176011 The higher expression of cyclin A may predict a poor prognosis for childhood ALL.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19056339 Cyclin A1- and cyclin A2-containing CDK complexes were compared in vitro by determining kinetic constants and by examining the complexes for their ability to phosphorylate pRb and p53.
18829481 sarcomatous transformation of diffuse-type tenosynovial giant cell tumors involves aberrations of cyclin A, P53, and chromosome arm 15q
18676680 Observational study of gene-disease association. (HuGE Navigator)
18668132 there was no evidence of an accumulation of cyclin A-positive childhood acute lymphoblastic leukemia cells that are unable to progress through the S phase.
18667424 the cyclin A-CDK2 complex may be a potential effector of NFATs, specifically NFATc1, in mediating SMC multiplication leading to neointima formation.
18635963 Cyclin A-CDK activity during G(1) would result in an inhibition of progression into the S phase.
18572908 cyclin A 2 stability depended on pH
18490441 Study concludes that the increase in cyclin A/Cdk1 activity at the end of S phase triggers degradation of SLBP at S/G(2).
18471975 Data show that Cdc20 and Cks1 direct the spindle checkpoint-independent destruction of cyclin A2.
18391017 JunB levels, which are high in S phase, drop during mid- to late G2 phase due to accelerated phosphorylation-dependent degradation by the proteasome, and are required for subsequent reduction of cyclin A2 levels in prometaphase
18368381 FBI-1 is the first transcriptional repressor shown to act as a dual regulator in adipogenesis exerting repressor activities on target genes by both, direct and indirect mechanisms.
18246796 Cyclin A2-siRNAs can induce obvious inhibition of cyclin A2 mRNA and protein expression in MG-63 and HSF cells, which consequently down-regulate the proliferation of MG-63 cells.
17917837 The enhanced expression of cyclin A was linked with cell proliferation in LSCC, ED, and NM. No association was observed between cyclin E and A and other clinicopathologic parameters.
17868400 Data demonstrated that in addition to galectin-3, HK III and cyclin A profiles could be important biomarkers in predicting malignancy in follicular thyroid nodules.
17698606 Study describes the biochemically purification and identification of SCAPER, a novel protein that specifically interacts with cyclin A/Cdk2 in vivo.
17636382 These findings suggest novel Cdk1/cyclin A phosphorylation sites, which appear to be associated with p53-independent cell death following etoposide treatment.
17593077 epithelial component of the tumours expressed cyclin A in a statistically significantly higher number of carcinoma ex pleomorphic adenoma cases compared with the pleomorphic adenoma cases
17495531 The cyclin A recruitment site is used to recruit substrates containing an RXL motif. Because of sequence differences this site in cyclin A binds RXL motifs more strongly than in cyclin B.
17445807 Raloxifene increased the proliferation of HUVECs in association with enhanced gene expression of cyclins A and B1.
17359356 data strongly argue against mutational events of CDK1, cyclinB1 and cyclinA2 to play a role in gangliogliomas or focal cortical dysplasia
17316413 There was a highly significant positive association between p27(KIP-1) and estrogen receptor/progesterone receptor (ER/PR) status and with p27(KIP-1) and cyclin D1 expression. A trend between cyclin A and PR status was also identified.
17255290 Cyclin A may have a role in progression of Barrett's esophagus to esophageal adenocarcinoma
17208191 Cyclin A2 is required for timely nuclear-envelope breakdown, whereas cyclins B1 and B2 are not.
17013808 Cyclin A plays a critical role in c-myc signal transduction to differentiall regulate the cell cycle in lung fibroblasts and epithelial cells.
17001081 analysis of the NBI1-binding site on cyclin A which inhibits the catalytic activity of the complex cyclin-dependent kinase 2-cyclin A
16823179 Over-expression of cyclin A is associated with poor prognosis in breast cancer patients.
16774918 Skp2-cyclin A interaction serves to directly protect cyclin A-cyclin-dependent kinase (Cdk)2 from inhibition by p27 through competitive binding.
16708383 Cyclin A is an independent prognostic factor in gastric cancer, and one mechanism for its overexpression may depend on cytoplasmic localization of HuR
16670718 Cyclin A overexpression was significantly associated with poor metastasis-free survival both on tissue microarrays and large sections in breast cancer.
16540140 Here, we show that human papillomavirus type 16 16E1--E4 is also able to associate with cyclin A and Cdk2 during the G2 phase of the cell cycle.
16407256 molecular analysis of the CDK5/p25 and CDK2/cyclin A systems
16398674 It is considered that tumorigenesis with UC-associated dysplasia is of the bottom-up type, related to altered expression of cyclin A and p27(Kip1).
15671017 HTm4 binding to KAP.Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2
15649889 Results demonstrate that a peptide derived from the alpha5 helix of cyclin A significantly inhibits kinase activity of complexes harboring CDK2, and forms stable complexes with CDK2-cyclin A.
15601848 cyclin A/Cdk2 has a role as a progesterone receptor coactivator
15199159 cyclin A-cdk2 plays an ancillary noncatalytic role in the ubiquitination of p27(KIP1) by the SCF(skp2) complex
15187102 IL-1beta reduces the ability of IGF-I to activate Cdk2 and to induce E2F-1, cyclin A, and cyclin A-dependent phosphorylation of a retinoblastoma tumor suppressor
15050687 When expressed in astrocytes, neurons, and non-glial 293T cells, HIV-1 Tat interacts with a number of cell cycle-related proteins including cyclin A, cyclin B, cyclin D3, Cdk2, Cdk4, Cdk1/Cdc2, cdc6, p27, p53, p63, hdlg, and PCNA
14749377 Overexpression of cyclin A is unable to alter the nuclear localization of Cdc6
14747563 cyclin A bound tightly to Epstein-Barr virus nuclear antigen 3C (EBNA3C); EBNA3C interacted with cyclin A in vitro and associated with cyclin A complexes in EBV-transformed lymphoblastoid cell lines
14646596 significant difference in their biochemical properties between CDK4/cyclin D1 and CDK2/cyclin A affecting regulation of cellular RB function
14645522 HMGA2 associates with the E1A-regulated transcriptional repressor p120(E4F), interfering with p120(E4F) binding to the cyclin A promoter.
14579410 mechanism of cyclin A2 degradation in mouse two-cell embryos may be different from that in somatic cells
12742823 cyclin A is important regulator for cell cycle as well as for apoptosis
12673206 B-Myb repressor function is regulated by cyclin A phosphorylation and sequences within the C-terminal domain.
12601350 increases of cyclin D1, cyclin-dependent kinase 4, cyclin E, cyclin A, and Wee1 play an important role in the development of hepatocellular carcinoma from cirrhosis
12444551 CDK-independent transactivation of the estrogen receptor by cyclin D1 is, by itself, not sufficient to cause estradiol-independent growth of breast cancer cells. A vast overexpression of G1/S cyclins D1 A & E is able to do so by capturing CDK inhibitors.
11907280 found that cyclin A and cyclin E are able to regulate both nuclear and cytoplasmic events because they both shuttle between the nucleus and the cytoplasm
11896577 Centrosome overduplication, increased ploidy and transformation in cells expressing endoplasmic reticulum-associated cyclin A2

AA Sequence

MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTR      1 - 70
RVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKP     71 - 140
LVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSM    141 - 210
RAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVY    211 - 280
ITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKY    281 - 350
LPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG    351 - 420
VSLLNPPETLNL                                                              421 - 432
//

Text Mined References (190)

PMID Year Title
26960431 2016 Interphase APC/C-Cdc20 inhibition by cyclin A2-Cdk2 ensures efficient mitotic entry.
26706989 2015 Patterns of cyclin A and B1 immunostaining in papillary thyroid carcinoma.
26677902 2015 Induction of cell cycle arrest via the p21, p27-cyclin E,A/Cdk2 pathway in SMMC-7721 hepatoma cells by clioquinol.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26373553 2015 PIWIL2 promotes progression of non-small cell lung cancer by inducing CDK2 and Cyclin A expression.
26240284 2015 Histone Deacetylase 10 Regulates the Cell Cycle G2/M Phase Transition via a Novel Let-7-HMGA2-Cyclin A2 Pathway.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25615569 2015 Genome-wide association study follow-up identifies cyclin A2 as a regulator of the transition through cytokinesis during terminal erythropoiesis.
25596928 2015 MiR-22-silenced cyclin A expression in colon and liver cancer cells is regulated by bile acid receptor.
25501285 2015 Cell cycle marker expression in benign and malignant intraductal papillary lesions of the breast.
25393019 2014 PUL21a-Cyclin A2 interaction is required to protect human cytomegalovirus-infected cells from the deleterious consequences of mitotic entry.
25340978 2014 Cantharidin induces G2/M phase arrest by inhibition of Cdc25c and Cyclin A and triggers apoptosis through reactive oxygen species and the mitochondria?dependent pathways of A375.S2 human melanoma cells.
25220500 2014 Cyclin A2 and its associated kinase activity are required for optimal induction of progesterone receptor target genes in breast cancer cells.
24935000 2014 HDAC-inhibition counteracts everolimus resistance in renal cell carcinoma in vitro by diminishing cdk2 and cyclin A.
24824027 2014 Cyclin A predicts metastatic potential of rectal neuroendocrine tumors.
24795023 2014 C-terminal AKT phosphorylation by CDK2-cyclin A or mTOR activates AKT.
24670654 2014 Cell-cycle-regulated activation of Akt kinase by phosphorylation at its carboxyl terminus.
24622579 2014 CCNA2 is a prognostic biomarker for ER+ breast cancer and tamoxifen resistance.
24519066 2014 High expression of cyclin A is associated with poor prognosis in endometrial endometrioid adenocarcinoma.
24324728 2013 The prognostic value of mitotic activity index (MAI), phosphohistone H3 (PPH3), cyclin B1, cyclin A, and Ki67, alone and in combinations, in node-negative premenopausal breast cancer.
24302728 2014 APOLLON protein promotes early mitotic CYCLIN A degradation independent of the spindle assembly checkpoint.
24101496 2013 Human cytomegalovirus tegument protein pp150 acts as a cyclin A2-CDK-dependent sensor of the host cell cycle and differentiation state.
24013174 2013 Cyclin A regulates kinetochore microtubules to promote faithful chromosome segregation.
23815208 2013 Expression of cyclin A, cyclin E and p27 in normal, hyperplastic and frankly malignant endometrial samples.
23760262 2013 Histone deacetylase 3 regulates cyclin A stability.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23460259 2013 GRK2 negatively regulates IGF-1R signaling pathway and cyclins' expression in HepG2 cells.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23115005 2013 Synergistic effect of Bcl-2 and cyclin A2 on adverse recurrence-free survival in stage I non-small cell lung cancer.
23065011 2013 Human papillomavirus 18 E1^E4 protein interacts with cyclin A/CDK 2 through an RXL motif.
23028682 2012 Phosphorylation of Rad9 at serine 328 by cyclin A-Cdk2 triggers apoptosis via interfering Bcl-xL.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22810586 2012 Interpreting cancer genomes using systematic host network perturbations by tumour virus proteins.
22745723 2012 An intron-retaining splice variant of human cyclin A2, expressed in adult differentiated tissues, induces a G1/S cell cycle arrest in vitro.
22718829 2012 Inhibition of human cytomegalovirus immediate-early gene expression by cyclin A2-dependent kinase activity.
22711989 2012 Phosphorylation-dependent regulation of cyclin D1 and cyclin A gene transcription by TFIID subunits TAF1 and TAF7.
22465120 2012 Cyclin A regulates a cell-cycle-dependent expression of CKAP2 through phosphorylation of Sp1.
22232705 2012 A novel function for Cyclin A2: control of cell invasion via RhoA signaling.
21952639 2011 NIRF constitutes a nodal point in the cell cycle network and is a candidate tumor suppressor.
21871181 2011 NF-Y binds to both G1- and G2-specific cyclin promoters; a possible role in linking CDK2/Cyclin A to CDK1/Cyclin B.
21858804 2011 A functional single nucleotide polymorphism at the promoter region of cyclin A2 is associated with increased risk of colon, liver, and lung cancers.
21813648 2011 Protein phosphatase 2A (B55?) prevents premature activation of forkhead transcription factor FoxM1 by antagonizing cyclin A/cyclin-dependent kinase-mediated phosphorylation.
21762277 2012 Clinicopathological significance of cyclooxygenase-2 and cell cycle-regulatory proteins expression in patients with esophageal squamous cell carcinoma.
21596315 2011 Deubiquitinase USP37 is activated by CDK2 to antagonize APC(CDH1) and promote S phase entry.
21472690 2011 Expression of cell-cycle regulatory proteins BUBR1, MAD2, Aurora A, cyclin A and cyclin E in invasive ductal breast carcinomas.
21464733 2011 Significance of cell cycle regulatory proteins as malignant and prognostic biomarkers in ovarian epithelial tumors.
21336306 2011 How APC/C-Cdc20 changes its substrate specificity in mitosis.
21269460 2011 Initial characterization of the human central proteome.
21264543 2012 Cyclin A and cyclin B1 overexpression in differentiated thyroid carcinoma.
21078875 2011 Cyclin A promotes S-phase entry via interaction with the replication licensing factor Mcm7.
21046779 2010 [The expression of Cyclin A and p21cip1 in fibroblast of hypertrophic scar].
20857402 2011 Homocysteine induces smooth muscle cell proliferation through differential regulation of cyclins A and D1 expression.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20733051 2010 How cyclin A destruction escapes the spindle assembly checkpoint.
20660152 2010 The roles of cyclin A2, B1, and B2 in early and late mitotic events.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20193482 2010 Prediction of recurrence risk in early breast cancer using human epidermal growth factor 2 and cyclin A2.
20133761 2010 Discovery of a distinct domain in cyclin A sufficient for centrosomal localization independently of Cdk binding.
20126974 2010 The pure anti-androgen bicalutamide inhibits cyclin A expression both in androgen-dependent and -independent cell lines.
19901524 2009 Cyclin A overexpression induces chromosomal double-strand breaks in mammalian cells.
19864233 2009 Aberrant expression of cyclin a correlates with morphogenesis of reed-sternberg cells in Hodgkin lymphoma.
19858290 2010 A bifunctional regulatory element in human somatic Wee1 mediates cyclin A/Cdk2 binding and Crm1-dependent nuclear export.
19822658 2009 Cyclin A2-cyclin-dependent kinase 2 cooperates with the PLK1-SCFbeta-TrCP1-EMI1-anaphase-promoting complex/cyclosome axis to promote genome reduplication in the absence of mitosis.
19738611 2009 Cell cycle genes and ovarian cancer susceptibility: a tagSNP analysis.
19703905 2009 Cyclin A/cdk2 regulates adenomatous polyposis coli-dependent mitotic spindle anchoring.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19684852 2009 Knocking-down cyclin A(2) by siRNA suppresses apoptosis and switches differentiation pathways in K562 cells upon administration with doxorubicin.
19671680 2009 MDM2 controls the timely expression of cyclin A to regulate the cell cycle.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19614764 2009 Expression and prognostic significance of cyclin B1 and cyclin A in non-small cell lung cancer.
19596857 2009 Mechanisms of resistance to interferon-gamma-mediated cell growth arrest in human oral squamous carcinoma cells.
19483727 2009 Degradation of cyclin A is regulated by acetylation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19363140 2009 Gene expression profiles of acute exacerbations of idiopathic pulmonary fibrosis.
19176011 2008 [Expression of cyclin A in childhood acute leukemia and its significance].
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19056339 2009 Distinct properties of cyclin-dependent kinase complexes containing cyclin A1 and cyclin A2.
18829481 2008 Immunohistochemical and biogenetic features of diffuse-type tenosynovial giant cell tumors: the potential roles of cyclin A, P53, and deletion of 15q in sarcomatous transformation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18668132 2009 Expression of cyclin A in childhood acute lymphoblastic leukemia cells reveals undisturbed G1-S phase transition and passage through the S phase.
18667424 2008 NFATc1 targets cyclin A in the regulation of vascular smooth muscle cell multiplication during restenosis.
18635963 2008 Cyclin A-CDK activity during G1 phase impairs MCM chromatin loading and inhibits DNA synthesis in mammalian cells.
18572908 2008 Biophysical studies on the full-length human cyclin A2: protein stability and folding/unfolding thermodynamics.
18490441 2008 Phosphorylation of threonine 61 by cyclin a/Cdk1 triggers degradation of stem-loop binding protein at the end of S phase.
18471975 2008 Cdc20 and Cks direct the spindle checkpoint-independent destruction of cyclin A.
18391017 2008 JunB breakdown in mid-/late G2 is required for down-regulation of cyclin A2 levels and proper mitosis.
18368381 2008 Transcription factor FBI-1 acts as a dual regulator in adipogenesis by coordinated regulation of cyclin-A and E2F-4.
18246796 2007 [Knockdown of cyclin A2 expression by small interfering RNA in MG-63 cells].
17917837 2008 Clinicopathologic significance and prognostic role of cyclin E and cyclin A expression in laryngeal epithelial lesions.
17868400 2008 Hexokinase III, cyclin A and galectin-3 are overexpressed in malignant follicular thyroid nodules.
17698606 2007 SCAPER, a novel cyclin A-interacting protein that regulates cell cycle progression.
17636382 2007 New alternative phosphorylation sites on the cyclin dependent kinase 1/cyclin a complex in p53-deficient human cells treated with etoposide: possible association with etoposide-induced apoptosis.
17593077 2007 Cyclin A expression and its diagnostic value in pleomorphic adenoma and carcinoma expleomorphic adenoma of the parotid gland.
17495531 2007 Cyclin B and cyclin A confer different substrate recognition properties on CDK2.
17445807 2007 Raloxifene increases proliferation of human endothelial cells in association with increased gene expression of cyclins A and B1.
17359356 2007 Mutational and expression analysis of CDK1, cyclinA2 and cyclinB1 in epilepsy-associated glioneuronal lesions.
17316413 2007 p27KIP-1, cyclin A and cyclin D1 protein expression in ductal carcinoma in situ of the breast: p27KIP-1 correlates with hormone receptor status but not with local recurrence.
17255290 2007 Cyclin A immunocytology as a risk stratification tool for Barrett's esophagus surveillance.
17254966 2007 Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.
17208191 2007 Cyclin A2 regulates nuclear-envelope breakdown and the nuclear accumulation of cyclin B1.
17013808 2007 Cyclin A but not cyclin D1 is essential for c-myc-modulated cell-cycle progression.
17001081 2006 Identification of an hexapeptide that binds to a surface pocket in cyclin A and inhibits the catalytic activity of the complex cyclin-dependent kinase 2-cyclin A.
16823179 2006 The prognostic value and overexpression of cyclin A is correlated with gene amplification of both cyclin A and cyclin E in breast cancer patient.
16774918 2006 Skp2 contains a novel cyclin A binding domain that directly protects cyclin A from inhibition by p27Kip1.
16708383 2006 Prognostic significance of cyclin A in gastric cancer.
16670718 2006 Reliability of cyclin A assessment on tissue microarrays in breast cancer compared to conventional histological slides.
16540140 2006 HPV16 E1--E4 protein is phosphorylated by Cdk2/cyclin A and relocalizes this complex to the cytoplasm.
16407256 2006 Different mechanisms of CDK5 and CDK2 activation as revealed by CDK5/p25 and CDK2/cyclin A dynamics.
16398674 2006 Bottom-up cell proliferation with cyclin A and p27Kip1 expression in ulcerative colitis-associated dysplasia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16209941 2005 Structural basis of the Cks1-dependent recognition of p27(Kip1) by the SCF(Skp2) ubiquitin ligase.
16109376 2005 The bromodomain protein Brd4 is a positive regulatory component of P-TEFb and stimulates RNA polymerase II-dependent transcription.
16061792 2005 Association of the human papillomavirus type 16 E7 oncoprotein with the 600-kDa retinoblastoma protein-associated factor, p600.
15890360 2005 Molecular basis for the specificity of p27 toward cyclin-dependent kinases that regulate cell division.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15671017 2005 Binding of HTm4 to cyclin-dependent kinase (Cdk)-associated phosphatase (KAP).Cdk2.cyclin A complex enhances the phosphatase activity of KAP, dissociates cyclin A, and facilitates KAP dephosphorylation of Cdk2.
15649889 2005 Design of a novel class of peptide inhibitors of cyclin-dependent kinase/cyclin activation.
15601848 2005 Cyclin-dependent kinase activity is required for progesterone receptor function: novel role for cyclin A/Cdk2 as a progesterone receptor coactivator.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15239650 2004 N2-substituted O6-cyclohexylmethylguanine derivatives: potent inhibitors of cyclin-dependent kinases 1 and 2.
15199159 2004 Noncatalytic requirement for cyclin A-cdk2 in p27 turnover.
15189033 2004 3-Aminopyrazole inhibitors of CDK2/cyclin A as antitumor agents. 1. Lead finding.
15187102 2004 IL-1beta suppresses prolonged Akt activation and expression of E2F-1 and cyclin A in breast cancer cells.
14993212 2004 Cdt1 phosphorylation by cyclin A-dependent kinases negatively regulates its function without affecting geminin binding.
14749377 2004 Cdc6 chromatin affinity is unaffected by serine-54 phosphorylation, S-phase progression, and overexpression of cyclin A.
14747563 2004 Epstein-Barr virus nuclear antigen 3C regulates cyclin A/p27 complexes and enhances cyclin A-dependent kinase activity.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14646596 2003 Biochemical characterizations reveal different properties between CDK4/cyclin D1 and CDK2/cyclin A.
14645522 2003 Transcriptional activation of the cyclin A gene by the architectural transcription factor HMGA2.
14579410 2003 Cyclin A2 is phosphorylated during the G2/M transition in mouse two-cell embryos.
12941338 2003 Structure-based design of 2-arylamino-4-cyclohexylmethyl-5-nitroso-6-aminopyrimidine inhibitors of cyclin-dependent kinases 1 and 2.
12742823 2003 Upregulation of Cdc2 and cyclin A during apoptosis of endothelial cells induced by cleaved high-molecular-weight kininogen.
12673206 2003 B-Myb repressor function is regulated by cyclin A phosphorylation and sequences within the C-terminal domain.
12601350 2003 Cyclins and cyclin-dependent kinases: comparative study of hepatocellular carcinoma versus cirrhosis.
12501191 2002 Specificity determinants of recruitment peptides bound to phospho-CDK2/cyclin A.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12444551 2002 Involvement of G1/S cyclins in estrogen-independent proliferation of estrogen receptor-positive breast cancer cells.
12439743 2002 B-Myb overcomes a p107-mediated cell proliferation block by interacting with an N-terminal domain of p107.
12244298 2002 Structure-based design of a potent purine-based cyclin-dependent kinase inhibitor.
11980909 2002 E2F-3B is a physiological target of cyclin A.
11907280 2002 Cyclin A- and cyclin E-Cdk complexes shuttle between the nucleus and the cytoplasm.
11884610 2002 Reversal of growth suppression by p107 via direct phosphorylation by cyclin D1/cyclin-dependent kinase 4.
11698641 2001 Phosphorylation of UBF at serine 388 is required for interaction with RNA polymerase I and activation of rDNA transcription.
11310559 2001 Identification of nuclear-import and cell-cycle regulatory proteins that bind to prothymosin alpha.
11238922 2001 HIRA, the human homologue of yeast Hir1p and Hir2p, is a novel cyclin-cdk2 substrate whose expression blocks S-phase progression.
10924145 2000 On the concentrations of cyclins and cyclin-dependent kinases in extracts of cultured human cells.
10884347 2000 The C-terminal regulatory domain of p53 contains a functional docking site for cyclin A.
10871850 2000 Degradation of B-Myb by ubiquitin-mediated proteolysis: involvement of the Cdc34-SCF(p45Skp2) pathway.
10864927 2000 An essential phosphorylation-site domain of human cdc25C interacts with both 14-3-3 and cyclins.
10679238 2000 Human p55(CDC)/Cdc20 associates with cyclin A and is phosphorylated by the cyclin A-Cdk2 complex.
10673397 2000 beta3-endonexin as a novel inhibitor of cyclin A-associated kinase.
10581175 1999 A novel human gene encoding HECT domain and RCC1-like repeats interacts with cyclins and is potentially regulated by the tumor suppressor proteins.
10540350 1999 Modulation of E2F activity in primary mouse B cells following stimulation via surface IgM and CD40 receptors.
10525536 1999 Human cyclin A is required for mitosis until mid prophase.
10373534 1999 BRCA1 is phosphorylated at serine 1497 in vivo at a cyclin-dependent kinase 2 phosphorylation site.
9889196 1999 Phosphorylation of mammalian CDC6 by cyclin A/CDK2 regulates its subcellular localization.
9858587 1999 Regulation of cyclin A-Cdk2 by SCF component Skp1 and F-box protein Skp2.
9820826 1998 Human carbon catabolite repressor protein (CCR4)-associative factor 1: cloning, expression and characterization of its interaction with the B-cell translocation protein BTG1.
9660973 1998 Functional analysis of the human TAFII250 N-terminal kinase domain.
9632134 1998 Cytoplasmic displacement of cyclin E-cdk2 inhibitors p21Cip1 and p27Kip1 in anchorage-independent cells.
9566895 1998 Human CDC6/Cdc18 associates with Orc1 and cyclin-cdk and is selectively eliminated from the nucleus at the onset of S phase.
9244350 1997 BRCA1 proteins are transported to the nucleus in the absence of serum and splice variants BRCA1a, BRCA1b are tyrosine phosphoproteins that associate with E2F, cyclins and cyclin dependent kinases.
9199321 1997 Specific regulation of E2F family members by cyclin-dependent kinases.
9054499 1997 Oncogenic ras provokes premature cell senescence associated with accumulation of p53 and p16INK4a.
9041194 1997 Characterization of a second human cyclin A that is highly expressed in testis and in several leukemic cell lines.
9020058 1997 Cyclin A is present in the endocytic compartment of rat liver cells and increases during liver regeneration.
8756328 1996 Structural basis of cyclin-dependent kinase activation by phosphorylation.
8684460 1996 Crystal structure of the p27Kip1 cyclin-dependent-kinase inhibitor bound to the cyclin A-Cdk2 complex.
8662825 1996 Cyclin-dependent kinases are inactivated by a combination of p21 and Thr-14/Tyr-15 phosphorylation after UV-induced DNA damage.
8626584 1996 Suppression of apoptosis by dominant negative mutants of cyclin-dependent protein kinases.
8502485 1993 G1 expression and multistage dynamics of cyclin A in human osteosarcoma cells.
8411358 1993 Simian virus 40 large T antigen associates with cyclin A and p33cdk2.
8253383 1993 The adenovirus E1A-associated 130-kD protein is encoded by a member of the retinoblastoma gene family and physically interacts with cyclins A and E.
8230483 1993 Analysis of p107-associated proteins: p107 associates with a form of E2F that differs from pRB-associated E2F-1.
8202514 1994 Structure and cell cycle-regulated transcription of the human cyclin A gene.
8024548 1994 Microsomal localization of cyclin A and cdk2 in proliferating rat liver cells.
7969176 1994 Cyclin A/CDK2 binds directly to E2F-1 and inhibits the DNA-binding activity of E2F-1/DP-1 by phosphorylation.
7630397 1995 Mechanism of CDK activation revealed by the structure of a cyclinA-CDK2 complex.
1967822 1990 Hepatitis B virus integration in a cyclin A gene in a hepatocellular carcinoma.
1962755 1990 Assignment of a human cyclin A gene to 4q26-q27.
1836977 1991 Cyclin A is required for the onset of DNA replication in mammalian fibroblasts.
1833062 1991 Cyclins and cancer.
1830372 1991 Cyclin A and the retinoblastoma gene product complex with a common transcription factor.
1675006 1991 A TaqI polymorphism in the human cyclin A gene.
1532458 1992 Interaction between human cyclin A and adenovirus E1A-associated p107 protein.
1387877 1992 Cytoplasmic accumulation of cyclin B1 in human cells: association with a detergent-resistant compartment and with the centrosome.
1312467 1992 Cyclin A is required at two points in the human cell cycle.