Property Summary

NCBI Gene PubMed Count 90
PubMed Score 170.98
PubTator Score 206.83

Knowledge Summary

Patent

No data available

Gene RIF (79)

PMID Text
26416449 our findings suggest that CCL18 released from tumor-associated macrophages promotes angiogenesis and tumor progression in breast cancer.
26294068 CCL18 is significantly up-regulated in breast cancer vs benign tumors or normal breast. It increased with the size of tumors, the number of lymph node metastasis, and advancing tumor stage.
26244871 Findings suggest that down-regulation of miR98 and miR27b promotes CCL18-mediated invasion and migration of breast cancer cells.
26113374 A common CCL18 polymorphism together with intraventricular hemorrhage had an additive influence on cerebral palsy susceptibility.
25794928 The CCL18 levels in serum and synovial fluid are correlated with the severity of osteoarthritis.
25502147 Combined functions of CCL18 in mesenchymal and cancer cells might accelerate the progression of PDAC by promoting the epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells.
25412496 CCL17 and CCL18 dermal expression is associated with leprosy polarity.
25275026 CCL18 expression was positively correlated with malignancy in EC.
25197632 upregulation of CCL18 may be involved in the malignant progression of prostate cancer.
25142483 Increased CCL18 levels characterize chronic Pseudomonas aeruginosa infection and pulmonary obstruction in patients with cystic fibrosis.
24823638 CCL18 from tumor-associated macrophages induces cancer cell epithelial-mesenchymal transition, forming a positive feedback loop, in coculture systems and humanized mice.
24747338 CCL-18 and IGFBP-6 were identified as new potential serum biomarkers for prostate cancer.
24142406 Pyk2 and Src are important in CCL18-induced breast cancer metastasis
24011266 Further development of A1AT as a diagnostic biomarker for BCa is warranted.
24001613 Data indicate that PYK2 N-terminal domain interacting receptor 1 (Nir1) could induce epithelial-mesenchymal transition by stabilising Snail via the PI3K/Akt/GSK3beta/Snail signalling pathway through binding to CCL18.
23999500 Identification of human CCR8 as a CCL18 receptor.
23932459 genetic polymorphism is associated with lung function in Hutterites, who are a founder population of European descent in North America
23786278 this review focuses on the potential role, in asthma and lung immunity, of CCL18 a chemokine both constitutively expressed at high levels in the lung and induced in inflammatory conditions
23742785 the Cys10-Cys34 disulfide bond is involved in the function of CCL18.
23588945 In patients with systemic sclerosis-related interstitial lung disease, CCL18 was a predictor of short-term decline in forced vital capacity. It was not a longterm prognostic indicator.
23433718 A high CCL18 level might be an independent biomarker for predicting better survival of patients with colorectal cancer.
23349697 CCL18 may be an interesting therapeutic target for NSCLC
23331560 CCL18 and YKL-40 levels and CHIT1 activity are enhanced in allergic airway inflammation and thus may contribute to airway remodelling in asthma.
23102918 enhanced production tolerogenic dendritic cells is associated with inhibition of allergic airway reactivity
23029519 IRF4 and CCL18 are novel genes expressed in periodontitis tissues, which may constitute potential therapeutic targets for future treatment strategies of periodontitis.
23029252 Serum CCL3, CCL5 and CCL18 are independently associated with the risk of short-term mortality in acute coronary syndrome patients.
22848587 correlation of serum level of CCL18 with survival time in non-small-cell lung cancer
22649201 CCL18 may contribute to maintaining tolerance and/or suppressing deleterious inflammation by attracting memory regulatory (Treg) cells into tissues, particularly in the lung, where it is highly and constitutively expressed.
22629457 CCL18 was a highly accurate biomarker for bladder cancer detection in this cohort.
22589264 Serum concentration of CCL18 reflects fibroinflammatory activity and extent of disease in patients with chronic periaortitis.
22404649 These results suggest that CCL18 may be associated with the development of cutaneous T-cell lymphoma.
22203932 IL-6 and CCL18 could clearly distinguish between women with breast cancers and healthy controls.
22117697 CCL18 functions as a maturation factor for monocytes leading to the development of macrophages in the M2 spectrum.
21943944 Overproduction of CCL18 might contribute to the pathogenesis of CRSwNP through its known activities, which include recruitment of lymphocytes and dendritic cells, activation of fibroblasts, and initiation of local inflammation.
21928244 Serum CCL18 and CXCL1 are potentially useful as novel circulating tumor markers for the differential diagnosis between ovarian cancer and benign ovarian masses.
21778167 serum CCL18 is an accurate predictive biomarker for the identification of patients with a higher risk of subsequent scleroderma lung disease worsening.
21539615 Serum levels of CCL18 correlate with the clinical severity score, serum eosinophil, and IgE levels in eczema and atopy.
21481794 CCL18 derived from Tumor-associated macrophages (TAMs) lays a critical role in promoting breast cancer metastasis via its receptor, PITPNM3.
21324976 High CCL18 is associated with functional deficiency and fibrosis of the peritoneal membrane.
21251883 Levels of CCL18 were raised least in meningeal TB, and most in pulmonary patients with long histories, when levels were similar to those in disease controls
20674579 CCL18/PARC is a potential diagnostic and prognostic parameter in patients with stable coronary artery disease.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20608885 Low cord blood CCL18 is an independent risk factor of intraventricular hemorrhage.
20568229 CCL18 is an important modulator of CXCR4-dependent responses in pre-B acute lymphocytic leukemia cells via interactions with GPR30.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19958819 results indicated that a significant production of CCL18/PARC in different CNS traumatic and neoplasm tissues by specific cellular elements expressing the chemokine
19937162 Serum CCL18 level was significantly elevated in epithelial ovarian cancer patients with early stages compared to those with late stages.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19808030 Determination of plasma chitotriosidase and CCL18 may be useful to monitor changes in granulomatous macrophages during the course of sarcoidosis
19423540 Observational study of gene-disease association. (HuGE Navigator)
19357939 CCL18 production by BAL-cells is down-regulated by chronic cigarette smoking and LPS contamination in cigarette smoke might be one factor involved
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19036375 CCL18 is predominantly expressed in human atherosclerotic plaques and may participate in the atherosclerotic plaque formation.
19017877 PARC, is elevated in sputum specimens from patients with asthma. PARC may play important roles in development of airway eosinophilic inflammation in asthma.
17979978 CCL18 expression didn't differ in PBMCs, sera and Langerhans cells from intrinsic and extrinsic subgroups, but CCL18 expression was observed in lesional skins and inflammatory dendritic epidermal cells in patients with extrinsic atopic dermatitis.
17909104 CCL18 and CCL5 are transiently raised during episodes of UAP, and peak levels of both chemokines are indicative of refractory symptoms.
17900259 Upregulation of CCL18 expression and downregulation of CX3CR1 expression play a role in immune responses against the adult t-cell leukemia cells.
17875202 CCl18 is expressed in synovial fluid neutrophils in patients with rheumatoid arthritis.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17469163 These findings suggest that CCL18 production by bronchoalveolar lavage cells and serum CCL18 concentrations reflect pulmonary fibrotic activity in patients with idiopathic interstitial pneumonias and those with systemic sclerosis.
17181634 Differential transcription occurring early in atopic dermatitis skin was indicated for CCL18, CCL13, IFNalpha2, PPARalpha and PPARgamma.
16984635 IL-10 synergistically induces CCL18 secretion in combination with IL-4 of IL-13 on monocytes and monocyte derived cells.
16773571 variation in the CCL18-CCL3-CCL4 chemokine gene cluster influences HIV Type 1 transmission and AIDS disease progression
16736095 urinary CCL18 levels are related to Gaucher cell burden in Gaucher patients
16670340 A new function for CCL18--the recruitment of Th2 cells and basophils--suggests that CCL18 may play a predominant role in allergic asthma.
16415274 Native collagen significantly up-regulated CCL18 expression in normal AMs activated with Th2 cytokines via a mechanism mediated by beta2-integrin/ scavenger receptor(s).
15702402 chitotriosidase and CCL18 have roles in formation of pathological lipid-laden macrophages in type B Niemann-Pick disease
15661937 Conclusive evidence links CCL18 protein expression with various stages of atopic dermatitis and demonstrates the capacity of CCL18 to recruit memory T cells into human skin in a SCID-hu mouse model.
15494534 Regulation of CCL18 by allergen exposure and microbial products suggests its important role in the initiation and amplification of atopic skin inflammation.
14578205 Serum PARC levels thus constitute a novel leukemia marker, possibly reflecting tumor/host cell interactions in the circulation
12949249 CCL18 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus.
12805086 Results suggest that pulmonary and activation-regulated chemokine is a member of the CC chemokine family that acts directly as a profibrotic factor.
12716654 Eosinophil production of PARC, its chemotactic effect on monocytes and lymphocytes, and PARC's previously described localization to the lung suggest that this chemokine might play a role in pulmonary leukocyte trafficking.
12646652 Investigation of the regulation of CCL18 production in maturing dendritic cells proposes that CCL18 may be part of an inhibitory pathway devoted to limiting the generation of specific immune responses at peripheral sites.
12626578 An in vivo role for DC-CK1 is shown in the establishment of primary T cell responses in mice indicating the potential of DC-CK1 as an adjuvant for vaccines against malaria as well as other diseases in which cellular immune responses are important.
12161279 mRNA for the chemokine PARC is expressed in the lower respiratory tract in both healthy subjects and patients with pulmonary sarcoidosis.

AA Sequence

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC      1 - 70
ADPNKKWVQKYISDLKLNA                                                        71 - 89
//

Text Mined References (91)

PMID Year Title
26416449 2015 CCL18 from tumor-associated macrophages promotes angiogenesis in breast cancer.
26294068 2015 Chemokine C-C motif ligand 18 expression correlates with tumor malignancy in breast cancer.
26244871 2015 CCL18-mediated down-regulation of miR98 and miR27b promotes breast cancer metastasis.
26113374 2015 Cerebral Palsy and Polymorphism of the Chemokine CCL18 in Very Preterm Children.
25794928 2015 Serum and synovial fluid levels of CCL18 are correlated with radiographic grading of knee osteoarthritis.
25502147 2015 CCL18 promotes epithelial-mesenchymal transition, invasion and migration of pancreatic cancer cells in pancreatic ductal adenocarcinoma.
25412496 2014 Differential dermal expression of CCL17 and CCL18 in tuberculoid and lepromatous leprosy.
25275026 2014 Expression of chemokine ligand 18 in stage IA low-grade endometrial cancer.
25197632 2014 CC chemokine ligand 18 correlates with malignant progression of prostate cancer.
25142483 2014 The chemokine CCL18 characterises Pseudomonas infections in cystic fibrosis lung disease.
24823638 2014 A positive feedback loop between mesenchymal-like cancer cells and macrophages is essential to breast cancer metastasis.
24747338 2014 CC chemokine ligand 18 and IGF-binding protein 6 as potential serum biomarkers for prostate cancer.
24142406 2014 Pyk2 and Src mediate signaling to CCL18-induced breast cancer metastasis.
24011266 2013 Investigation of CCL18 and A1AT as potential urinary biomarkers for bladder cancer detection.
24001613 2013 Nir1 promotes invasion of breast cancer cells by binding to chemokine (C-C motif) ligand 18 through the PI3K/Akt/GSK3?/Snail signalling pathway.
23999500 2013 Identification of human CCR8 as a CCL18 receptor.
23932459 2014 Genome-wide association study of lung function phenotypes in a founder population.
23786278 2013 Role of CCL18 in asthma and lung immunity.
23742785 2013 The disulfide bond between cysteine 10 and cysteine 34 is required for CCL18 activity.
23588945 2013 Can serum surfactant protein D or CC-chemokine ligand 18 predict outcome of interstitial lung disease in patients with early systemic sclerosis?
23433718 2013 CCL18 as an independent favorable prognostic biomarker in patients with colorectal cancer.
23349697 2013 CC-chemokine ligand 18 induces epithelial to mesenchymal transition in lung cancer A549 cells and elevates the invasive potential.
23331560 2013 Segmental allergen challenge enhances chitinase activity and levels of CCL18 in mild atopic asthma.
23102918 2012 Enhanced production of CCL18 by tolerogenic dendritic cells is associated with inhibition of allergic airway reactivity.
23029519 2012 Gene expression profiles in paired gingival biopsies from periodontitis-affected and healthy tissues revealed by massively parallel sequencing.
23029252 2012 Chemokines CCL3/MIP1?, CCL5/RANTES and CCL18/PARC are independent risk predictors of short-term mortality in patients with acute coronary syndromes.
22848587 2012 Serum level of CC-chemokine ligand 18 is increased in patients with non-small-cell lung cancer and correlates with survival time in adenocarcinomas.
22649201 2012 Pulmonary CCL18 recruits human regulatory T cells.
22629457 2012 CCL18 in a multiplex urine-based assay for the detection of bladder cancer.
22589264 2012 CCL18 -- potential biomarker of fibroinflammatory activity in chronic periaortitis.
22404649 2013 Increased CCL18 expression in patients with cutaneous T-cell lymphoma: association with disease severity and prognosis.
22203932 2011 Expression of CCL18 and interleukin-6 in the plasma of breast cancer patients as compared with benign tumor patients and healthy controls.
22117697 2012 The chemokine CCL18 causes maturation of cultured monocytes to macrophages in the M2 spectrum.
21943944 2012 Increased expression of CC chemokine ligand 18 in patients with chronic rhinosinusitis with nasal polyps.
21928244 Evaluation of proteomics-identified CCL18 and CXCL1 as circulating tumor markers for differential diagnosis between ovarian carcinomas and benign pelvic masses.
21778167 2011 Serum CC chemokine ligand-18 predicts lung disease worsening in systemic sclerosis.
21539615 2011 Exploring CCL18, eczema severity and atopy.
21481794 2011 CCL18 from tumor-associated macrophages promotes breast cancer metastasis via PITPNM3.
21324976 2011 Alternative activation of macrophages in human peritoneum: implications for peritoneal fibrosis.
21251883 2011 CCL2, CCL18 and sIL-4R in renal, meningeal and pulmonary TB; a 2 year study of patients and contacts.
20674579 2010 Cardiovascular determinants and prognostic significance of CC Chemokine Ligand-18 (CCL18/PARC) in patients with stable coronary artery disease.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20608885 2010 Chemokine CCL18 predicts intraventricular hemorrhage in very preterm infants.
20568229 2010 Attenuation of CXCR4 responses by CCL18 in acute lymphocytic leukemia B cells.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19958819 2010 CC-chemokine ligand 18/pulmonary activation-regulated chemokine expression in the CNS with special reference to traumatic brain injuries and neoplastic disorders.
19937162 2010 Clinical utility of circulating matrix metalloproteinase-7 (MMP-7), CC chemokine ligand 18 (CCL18) and CC chemokine ligand 11 (CCL11) as markers for diagnosis of epithelial ovarian cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19808030 2010 Plasma chitotriosidase and CCL18 as surrogate markers for granulomatous macrophages in sarcoidosis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19357939 2009 CCL18 production is decreased in alveolar macrophages from cigarette smokers.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19036375 2009 Expression of chemokine (C-C motif) ligand 18 in human macrophages and atherosclerotic plaques.
19017877 2009 Protein microarray analysis in patients with asthma: elevation of the chemokine PARC/CCL18 in sputum.
17979978 2008 Increased expression of CC chemokine ligand 18 in extrinsic atopic dermatitis patients.
17909104 2007 CC chemokine ligand-5 (CCL5/RANTES) and CC chemokine ligand-18 (CCL18/PARC) are specific markers of refractory unstable angina pectoris and are transiently raised during severe ischemic symptoms.
17900259 2007 Upregulation of CC chemokine ligand 18 and downregulation of CX3C chemokine receptor 1 expression in human T-cell leukemia virus type 1-associated lymph node lesions: Results of chemokine and chemokine receptor DNA chip analysis.
17875202 2007 Expression and regulation of CCL18 in synovial fluid neutrophils of patients with rheumatoid arthritis.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17469163 2007 CCL18 as an indicator of pulmonary fibrotic activity in idiopathic interstitial pneumonias and systemic sclerosis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17181634 2007 Early cutaneous gene transcription changes in adult atopic dermatitis and potential clinical implications.
16984635 2006 Novel insights in the regulation of CCL18 secretion by monocytes and dendritic cells via cytokines, toll-like receptors and rheumatoid synovial fluid.
16773571 2006 Genetic variation in the CCL18-CCL3-CCL4 chemokine gene cluster influences HIV Type 1 transmission and AIDS disease progression.
16736095 2006 CCL18: a urinary marker of Gaucher cell burden in Gaucher patients.
16670340 2006 Involvement of CCL18 in allergic asthma.
16415274 2006 A vicious circle of alveolar macrophages and fibroblasts perpetuates pulmonary fibrosis via CCL18.
15702402 2005 Plasma chitotriosidase and CCL18: early biochemical surrogate markers in type B Niemann-Pick disease.
15661937 2005 CCL18 is expressed in atopic dermatitis and mediates skin homing of human memory T cells.
15494534 2004 CC chemokine ligand 18, an atopic dermatitis-associated and dendritic cell-derived chemokine, is regulated by staphylococcal products and allergen exposure.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14578205 2003 PARC/CCL18 is a plasma CC chemokine with increased levels in childhood acute lymphoblastic leukemia.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12805086 2003 Pulmonary and activation-regulated chemokine stimulates collagen production in lung fibroblasts.
12716654 2004 Eosinophils and monocytes produce pulmonary and activation-regulated chemokine, which activates cultured monocytes/macrophages.
12646652 2003 Unique regulation of CCL18 production by maturing dendritic cells.
12626578 2003 The dendritic cell-specific chemokine, dendritic cell-derived CC chemokine 1, enhances protective cell-mediated immunity to murine malaria.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12161279 2002 Expression of the chemokine PARC mRNA in bronchoalveolar cells of patients with sarcoidosis.
11978786 2002 Identification of biologically active chemokine isoforms from ascitic fluid and elevated levels of CCL18/pulmonary and activation-regulated chemokine in ovarian carcinoma.
11745396 2001 Selective induction of CCL18/PARC by staphylococcal enterotoxins in mononuclear cells and enhanced levels in septic and rheumatoid arthritis.
10087196 1999 Genomic organization and biological characterization of the novel human CC chemokine DC-CK-1/PARC/MIP-4/SCYA18.
10049593 1999 Chemokine PARC gene (SCYA18) generated by fusion of two MIP-1alpha/LD78alpha-like genes.
9570561 1998 Alternative macrophage activation-associated CC-chemokine-1, a novel structural homologue of macrophage inflammatory protein-1 alpha with a Th2-associated expression pattern.
9233607 1997 A novel human CC chemokine PARC that is most homologous to macrophage-inflammatory protein-1 alpha/LD78 alpha and chemotactic for T lymphocytes, but not for monocytes.
9192897 1997 A dendritic-cell-derived C-C chemokine that preferentially attracts naive T cells.
9129202 1997 The chemokine information source: identification and characterization of novel chemokines using the WorldWideWeb and expressed sequence tag databases.