Property Summary

NCBI Gene PubMed Count 107
PubMed Score 183.29
PubTator Score 206.83

Knowledge Summary

Patent

No data available

Gene RIF (96)

AA Sequence

MKGLAAALLVLVCTMALCSCAQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC      1 - 70
ADPNKKWVQKYISDLKLNA                                                        71 - 89
//

Text Mined References (108)

PMID Year Title