Property Summary

NCBI Gene PubMed Count 56
PubMed Score 261.26
PubTator Score 85.69

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (38)

PMID Text
26722451 was to evaluate the possible association between CCL1 rs2072069 G/A or/and TLR2 rs3804099 T/C (T597C) polymorphisms and pulmonary tuberculosis (PTB) or/and tuberculous meningitis (TBM) in a sample of the Chinese adult population
26548923 The results of the present study demonstrated that GAS5 was able to suppress bladder cancer cell proliferation, at least partially, by suppressing the expression of CCL1.
23878309 These data identify a novel function for CCL1-CCR8 in metastasis and lymph node LECs as a critical checkpoint for the entry of metastases into the lymph nodes.
23811304 CCL1-CCR8 interaction may play a critical role in lymphocytic recruitment in IgG4-related sclerosing cholangitis and type 1 autoimmune pancreatitis, leading to duct-centred inflammation and obliterative phlebitis.
23333304 HIV-1 Vif downregulates the expression of chemokine (C-C motif) ligand 1 (CCL1) in Vif-expression T cells
22948508 CCL1, CCL26, and IgE may be associated with pruritus in cutaneous T-cell lymphoma.
22479563 C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity
22147355 There was a borderline association between a single nucleotide polymorphism located within the CCL1 gene and predisposition to tuberculosis using a singlepoint analysis
21849907 ACEI is effective in downregulating LPS-induced TNF-alpha, I-309, and IP-10, which play important roles in the pathogenesis of inflammation
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19865101 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19776237 The authors show here that PRV-gG binds to the human chemokine CL1 and several CC and CXC human chemokines with high affinity.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19372141 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19117730 serum CCL1 levels were slightly, but statistically significantly, correlated with serum IgE levels in patients with bullous pemphigoid.
19057661 6 single nucleotide polymorphisms in CCL1 were found to be associated with tuberculosis in a case-control genetic association study with 273 TB cases and 188 controls
17845580 Observational study of gene-disease association. (HuGE Navigator)
17703412 Observational study of gene-disease association. (HuGE Navigator)
17693327 The combination of 17beta-E(2) with the environmental pollutant TCDD is involved in the pathogenesis of endometriosis via up-regulating the chemokine CCR8-I-309.
17672898 Observational study of gene-disease association. (HuGE Navigator)
17641040 The mechanisms underlying the mast cell-CD4-positive T lymphocyte axis is determined by mast cell-derived CCL1 and a subset of CD4-positive T cells expressing CCR8.
17122780 Observational study of gene-disease association. (HuGE Navigator)
16864713 Observational study of gene-disease association. (HuGE Navigator)
16864713 Variants in the CCL1 gene are associated with susceptibility to AEs through their potential implication in the host defense mechanisms against AEs.
16735693 Thus, CCL1 is a CC chemokine with a unique pattern of regulation associated with a distinct form of M2 (Type 2, M2b) monocyte activation, which participates in macrophage-dependent regulatory circuits of innate and adaptive immunity.
16679317 Benzo(a)pyrene and an aryl hydrocarbon receptor agonist enhance activitity of te Ccl1 promoter.
16540498 CC chemokine ligand 1 may play a role in lymphocyte recruitment in bronchial asthma
15814739 the axis CCL1-CCR8 links adaptive and innate immune functions that play a role in the initiation and amplification of atopic skin inflammation
14630801 HIV-1 Vif downregulates the expression of chemokine (C-C motif) ligand 1 (CCL1) in Vif-expression T cells
12949249 CCL1 is an antimicrobial protein with bacteriocidal activity against E. coli and S. aureus.
12645948 Transfected human CCL1 up-regulated ERK1/2 MAPK phosphorylation in BW5147 cells. CCL1 activates the MAPK pathway in CCR8-transfected CHO cells.
12393595 After stimulation via high-affinity FcepsilonRI, the transcriptional levels of I-309 (CCL1), MIP-1alpha (CCL3) and MIP-1beta (CCL4) were found among the 10 most increased human and mouse transcripts from approximately 12 000 genes
10985253 HIV-1 Vif downregulates the expression of chemokine (C-C motif) ligand 1 (CCL1) in Vif-expression T cells

AA Sequence

MQIITTALVCLLLAGMWPEDVDSKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGK      1 - 70
EACALDTVGWVQRHRKMLRHCPSKRK                                                 71 - 96
//

Text Mined References (57)

PMID Year Title
26722451 2015 Genetic polymorphisms of CCL1 rs2072069 G/A and TLR2 rs3804099 T/C in pulmonary or meningeal tuberculosis patients.
26548923 2016 Long non?coding RNA?GAS5 acts as a tumor suppressor in bladder transitional cell carcinoma via regulation of chemokine (C?C motif) ligand 1 expression.
23878309 2013 Tumor cell entry into the lymph node is controlled by CCL1 chemokine expressed by lymph node lymphatic sinuses.
23811304 2013 Possible involvement of CCL1-CCR8 interaction in lymphocytic recruitment in IgG4-related sclerosing cholangitis.
22948508 2013 Association of nerve growth factor, chemokine (C-C motif) ligands and immunoglobulin E with pruritus in cutaneous T-cell lymphoma.
22479563 2012 C-terminal clipping of chemokine CCL1/I-309 enhances CCR8-mediated intracellular calcium release and anti-apoptotic activity.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
22147355 2011 Tuberculosis susceptibility genes in the chemokine cluster region of chromosome 17 in Hong Kong Chinese.
21849907 2011 Suppressive effects of imidapril on Th1- and Th2-related chemokines in monocytes.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
19865101 2010 Genetic variants of CC chemokine genes in experimental autoimmune encephalomyelitis, multiple sclerosis and rheumatoid arthritis.
19776237 2010 Glycoprotein G from pseudorabies virus binds to chemokines with high affinity and inhibits their function.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19372141 2009 Candidate gene approach evaluates association between innate immunity genes and breast cancer risk in Korean women.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19117730 2009 Increased CCL1 levels in the sera and blister fluid of patients with bullous pemphigoid.
19057661 2008 Identification of tuberculosis susceptibility genes with human macrophage gene expression profiles.
17845580 2007 The polymorphisms of Eotaxin 1 and CCR3 genes influence on serum IgE, Eotaxin levels and mild asthmatic children in Taiwan.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17693327 2007 Combination of 17beta-estradiol with the environmental pollutant TCDD is involved in pathogenesis of endometriosis via up-regulating the chemokine I-309-CCR8.
17672898 2007 Analysis of single nucleotide polymorphism in the promoter and protein expression of the chemokine eotaxin-1 in colorectal cancer patients.
17641040 2007 Coordinated involvement of mast cells and T cells in allergic mucosal inflammation: critical role of the CC chemokine ligand 1:CCR8 axis.
17122780 2007 Genome-wide scan for visceral leishmaniasis susceptibility genes in Brazil.
16864713 2006 A single nucleotide polymorphism in the CCL1 gene predicts acute exacerbations in chronic obstructive pulmonary disease.
16735693 2006 Differential regulation of chemokine production by Fcgamma receptor engagement in human monocytes: association of CCL1 with a distinct form of M2 monocyte activation (M2b, Type 2).
16679317 2006 Aryl hydrocarbon receptor- and calcium-dependent induction of the chemokine CCL1 by the environmental contaminant benzo[a]pyrene.
16540498 2006 CC chemokine ligand 1 is released into the airways of atopic asthmatics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15814739 2005 CCL1-CCR8 interactions: an axis mediating the recruitment of T cells and Langerhans-type dendritic cells to sites of atopic skin inflammation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630801 2004 Migration of V delta 1 and V delta 2 T cells in response to CXCR3 and CXCR4 ligands in healthy donors and HIV-1-infected patients: competition by HIV-1 Tat.
12967681 2003 Human cord blood-derived mast cells synthesize and release I-309 in response to IgE.
12949249 2003 Many chemokines including CCL20/MIP-3alpha display antimicrobial activity.
12645948 2003 CCR8-dependent activation of the RAS/MAPK pathway mediates anti-apoptotic activity of I-309/ CCL1 and vMIP-I.
12489497 2002 Chemokine receptor-8: potential role in atherogenesis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393595 2002 Marked increase in CC chemokine gene expression in both human and mouse mast cell transcriptomes following Fcepsilon receptor I cross-linking: an interspecies comparison.
11818437 2002 Role of chemokines in the biology of natural killer cells.
11133740 2001 The chemokine receptor CCR8 mediates human endothelial cell chemotaxis induced by I-309 and Kaposi sarcoma herpesvirus-encoded vMIP-I and by lipoprotein(a)-stimulated endothelial cell conditioned medium.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10985253 2000 HIV-1 Vpr regulates expression of beta chemokines in human primary lymphocytes and macrophages.
10942748 2000 CC chemokine I-309 is the principal monocyte chemoattractant induced by apolipoprotein(a) in human vascular endothelial cells.
10821677 2000 Human CC chemokine I-309, structural consequences of the additional disulfide bond.
10648464 2000 Differential expression of chemokines in normal pancreas and in chronic pancreatitis.
10409433 1999 Physical mapping of the CC-chemokine gene cluster on the human 17q11. 2 region.
9417093 1998 The CC chemokine I-309 inhibits CCR8-dependent infection by diverse HIV-1 strains.
9211859 1997 Identification of CCR8, the receptor for the human CC chemokine I-309.
8077676 1994 The chemokines IL-8, monocyte chemoattractant protein-1, and I-309 are monomers at physiologically relevant concentrations.
2809212 1989 A novel polypeptide secreted by activated human T lymphocytes.
2212659 1990 Sequence and chromosomal location of the I-309 gene. Relationship to genes encoding a family of inflammatory cytokines.
1557400 1992 The human cytokine I-309 is a monocyte chemoattractant.