Property Summary

NCBI Gene PubMed Count 81
PubMed Score 532.00
PubTator Score 256.25

Knowledge Summary

Patent (16,627)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -2.300 3.3e-10

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652083 other 0 / 0 / 0 Late-stage results from the probe development effort to identify antagonists of OPRK1: CEREP radiometric-based biochemical counterscreen panel assay

Gene RIF (68)

PMID Text
26608796 The neurotransmitter cholecystokinin (CCK), along with its receptors, CCKAR and CCKBR, have been previously associated with psychiatric disorders, suggesting that variants near these genes may play a role in the pre-pulse/startle response in this cohort
26551933 CCK-AR polymorphism is protective against functional dyspepsia.
25875176 There is functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25025063 Age related differential expression of CCKAR in GBC may suggest two possible variants of the disease in this endemic belt.
24914377 CCK binding modulates the contractile function of the lower esophageal sphincter through differential binding to the CCK-A receptor on the sling and clasp fibers
24825903 Y140A mutation within a cholesterol-binding motif results in ligand binding and activity characteristics similar to wild type CCK1R. in a high cholesterol environment
23701593 The findings suggest that variants in the CCKAR gene may influence the risk of gallbladder cancer in women.
23341962 A significant association of the cholecystokinin-A receptor (CCKAR) gene variation rs1800857 and language lateralization, is reported.
22825913 The results showed that three individual haplotypes of CCKAR were strongly associated with increased risk of schizophrenia.
22396142 Data suggest that CCK-1R expression is up-regulated in kidney tubules (but not in glomeruli) in patients with diabetic nephropathy; increased expression of CCK-1R in tubules appears to be biomarker of severity of proteinuria in these patients.
22021636 data may suggest that the TM3 CRAC cholesterol-binding motif could be responsible for the cholesterol sensitivity of the CCK1R.
21813391 CCKAR expression was significantly increased in gallbladder cancer compared to gallstone disease.
21728335 Data indicate that the Homo-Phe derivative 2 (VL-0797) enhanced 12-fold the affinity for the rat CCK(1)-R affinity and 15-fold for the human CCK(1)-R relative to the reference compound 12 (VL-0395).
20732371 An association is not found between cholecystokinin A receptor polymorphisms and antipsychotic induced weight gain in schizophrenia patients.
20732371 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20558763 Impaired muscle contraction in gallbladders with cholesterol stones is due to high caveolar levels of cholesterol that inhibits CAV-3 generation; cholesterol increases the caveolar sequestration of CAV-3 and CCK-1R.
20538960 Observational study of gene-disease association. (HuGE Navigator)
20535329 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20424473 Observational study of gene-disease association. (HuGE Navigator)
20351714 Observational study of gene-disease association. (HuGE Navigator)
20023595 a 2-marker haplotype (rs1800855/rs1800857) in the CCKAR gene protected women against PD (P=0.004). In addition, we found two novel rare missense variations in the CCKBR gene (Lys329Asn and Pro446Leu) in two and one patient, respectively
20023595 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19760980 Observational study of gene-disease association. (HuGE Navigator)
19753663 an intron 1 polymorphism in the cholecystokinin A receptor gene is associated with schizophrenia in males
19753663 Observational study of gene-disease association. (HuGE Navigator)
19751565 LPS can up-regulate the expression of CCK-AR and CCK-BR mRNA in vascular endothelial cells.
19086053 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18832011 Observational study of gene-disease association. (HuGE Navigator)
18776046 Report effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation.
18583979 Meta-analysis of gene-disease association. (HuGE Navigator)
18444993 Responses of human esophageal sphincter sling and clasp fibers to cholecystokinin (CCK) and gastrin through CCK-A and -B receptors are reported.
17944886 Observational study of gene-disease association. (HuGE Navigator)
17597711 CCK-A receptor agonist, GI181771X, did not reduce body in obese patients, suggesting that CCK-A by itself does not have a central role in long-term energy balance.
17457313 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17413452 Observational study of gene-disease association. (HuGE Navigator)
17413452 No evidence for the association between the CCK-AR gene and schizophrenia in the Japanese population.
17413443 Observational study of gene-disease association. (HuGE Navigator)
17413443 possible role of the CCK-AR gene in the vulnerability to schizophrenia in patients with auditory hallucinations
16362631 Observational study of gene-disease association. (HuGE Navigator)
15927089 Observational study of gene-disease association. (HuGE Navigator)
15786550 the deficiency of CCK-R may be a key point leading to the impairment of gallbladder motor function and the pathogenesis of cholesterol gallstone formation
15740988 Observational study of gene-disease association. (HuGE Navigator)
15723764 Observational study of gene-disease association. (HuGE Navigator)
15723764 Finds significant differences in intelligence for Cholecystokinin A receptor gene promoter polymorphisms A-81G and G-128T in community-living Japanese.
15632187 analysis of partial and full agonism mediated by the human cholecystokinin-1 receptor
15363473 Observational study of gene-disease association. (HuGE Navigator)
15363473 CCK-AR gene is suggested to predispose persons to schizophrenia.
15340101 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15313848 Observational study of gene-disease association. (HuGE Navigator)
15108185 Observational study of gene-disease association. (HuGE Navigator)
15108185 CCK-AR gene polymorphism may be involved in the neurobiology of panic disorder.
15100163 In this review, both localization and functional studies suggest that the motor effects of cholecystokinin are mediated by CCK1/CCKA receptors in humans.
14691070 Observational study of gene-disease association. (HuGE Navigator)
14534299 heterodimerization of type A and B cholecystokinin receptors forms a powerful signaling unit with potential clinical significance in promoting cell growth
12851875 the presence of CCK receptors in human ductal pancreatic tumor samples is mainly due to CCK2 expression in residual pancreatic islets and CCK1 in pancreatic nerves.
12777967 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12777967 in Chinese, visual hallucinations in Parkinson's disease are associated with cholecystokinin -45C>T polymorphism, and this association was still observed in the presence of the cholecystokinin-A receptor TC/CC genotype
12627462 Observational study of gene-disease association. (HuGE Navigator)
12198366 Observational study of gene-disease association. (HuGE Navigator)
12198366 Significant association between polymorphism at the -85 locus of the CCKAR gene in patients with hallucination, especially patients with hallucination in delirium tremens.
11549403 Observational study of gene-disease association. (HuGE Navigator)
11368834 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK      1 - 70
RMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERY     71 - 140
GAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWH    141 - 210
TFLLLILFLIPGIVMMVAYGLISLELYQGIKFEASQKKSAKERKPSTTSSGKYEDSDGCYLQKTRPPRKL    211 - 280
ELRQLSTGSSSRANRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGT    281 - 350
PISFILLLSYTSSCVNPIIYCFMNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGGTTGASLSRFSYSH    351 - 420
MSASVPPQ                                                                  421 - 428
//

Text Mined References (82)

PMID Year Title
26608796 2015 Variants Near CCK Receptors are Associated With Electrophysiological Responses to Pre-pulse Startle Stimuli in a Mexican American Cohort.
26551933 2016 Functional dyspepsia is associated with GN?3 C825T and CCK-AR T/C polymorphism.
25875176 2015 Functional synergy between cholecystokinin receptors CCKAR and CCKBR in mammalian brain development.
25025063 2014 Differential expression of cholecystokinin A receptor in gallbladder cancer in the young and elderly suggests two subsets of the same disease?
24914377 2014 Investigation of cholecystokinin receptors in the human lower esophageal sphincter.
24825903 2014 A type 1 cholecystokinin receptor mutant that mimics the dysfunction observed for wild type receptor in a high cholesterol environment.
23701593 2013 Variants in CCK and CCKAR genes to susceptibility to biliary tract cancers and stones: a population-based study in Shanghai, China.
23341962 2013 Cholecystokinin A receptor (CCKAR) gene variation is associated with language lateralization.
22825913 2012 Investigation of allelic heterogeneity of the CCK-A receptor gene in paranoid schizophrenia.
22396142 2012 Expression of cholecystokinin-1 receptor is correlated with proteinuria in human diabetic nephropathy.
22021636 2012 Differential sensitivity of types 1 and 2 cholecystokinin receptors to membrane cholesterol.
21813391 2011 Expression profile of cholecystokinin type-A receptor in gallbladder cancer and gallstone disease.
21728335 2011 New anthranilic acid based antagonists with high affinity and selectivity for the human cholecystokinin receptor 1 (hCCK1-R).
20732371 2010 Association study of polymorphisms in cholecystokinin gene and its receptors with antipsychotic induced weight gain in schizophrenia patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20558763 2010 Effects of cholesterol on CCK-1 receptors and caveolin-3 proteins recycling in human gallbladder muscle.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20535329 2010 Association of CCK(1) Receptor Gene Polymorphisms and Irritable Bowel Syndrome in Korean.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20351714 2011 Poor replication of candidate genes for major depressive disorder using genome-wide association data.
20023595 2010 Gene variations in the cholecystokinin system in patients with panic disorder.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19760980 779 TC of CCK-1 intron 1 is associated with postprandial syndrome (PDS) in Japanese male subjects.
19753663 2009 An intron 1 polymorphism in the cholecystokinin-A receptor gene associated with schizophrenia in males.
19751565 2009 [The expression of cholecystokinin-octapeptide receptor in vascular endothelial cells induced by lipopolysaccharide].
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18832011 2008 Association testing of panic disorder candidate genes using CCK-4 challenge in healthy volunteers.
18776046 2008 Effects of cholecystokinin-58 on type 1 cholecystokinin receptor function and regulation.
18583979 2008 Systematic meta-analyses and field synopsis of genetic association studies in schizophrenia: the SzGene database.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18444993 2008 Responses of human sling and clasp fibers to cholecystokinin (CCK) and gastrin through CCK receptors.
17944886 2008 Cholecystokinin receptor A gene polymorphism in gallstone disease and gallbladder cancer.
17597711 2008 Stimulation of cholecystokinin-A receptors with GI181771X does not cause weight loss in overweight or obese patients.
17457313 2007 Association analysis of the chromosome 4p15-p16 candidate region for bipolar disorder and schizophrenia.
17413452 2007 Association study between the cholecystokinin A receptor gene and schizophrenia in the Japanese population.
17413443 2007 Association between CCK-AR gene and schizophrenia with auditory hallucinations.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
16362631 2006 Association of ghrelin receptor gene polymorphism with bulimia nervosa in a Japanese population.
15927089 2006 Analysis of SNP profiles in patients with major depressive disorder.
15786550 2005 Gallbladder motor function, plasma cholecystokinin and cholecystokinin receptor of gallbladder in cholesterol stone patients.
15740988 2005 Cholecystokinin (CCK) and the CCKA receptor gene polymorphism, and smoking behavior.
15723764 2005 Cholecystokinin A receptor gene promoter polymorphism and intelligence.
15634012 2005 Modeled structure of a G-protein-coupled receptor: the cholecystokinin-1 receptor.
15632187 2005 Molecular mechanism underlying partial and full agonism mediated by the human cholecystokinin-1 receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15363473 2004 A possible association between the CCK-AR gene and persistent auditory hallucinations in schizophrenia.
15340101 2004 Association of cholecystokinin 1 receptor and beta3-adrenergic receptor polymorphisms with midlife weight gain.
15313848 2004 Genetic polymorphisms in Parkinson disease subjects with and without hallucinations: an analysis of the cholecystokinin system.
15108185 2004 Association of cholecystokinin-A receptor gene polymorphisms and panic disorder in Japanese.
15100163 2004 Involvement of endogenous CCK and CCK1 receptors in colonic motor function.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14691070 Association of cholecystokinin-A receptor gene polymorphism with alcohol dependence in a Japanese population.
14534299 2003 Heterodimerization of type A and B cholecystokinin receptors enhance signaling and promote cell growth.
12851875 2003 Distribution of CCK1 and CCK2 receptors in normal and diseased human pancreatic tissue.
12801592 2003 Determination of ligand-receptor interactions of cholecystokinin by nuclear magnetic resonance.
12777967 2003 Cholecystokinin, cholecystokinin-A receptor and cholecystokinin-B receptor gene polymorphisms in Parkinson's disease.
12627462 2003 Association between the CCK-A receptor gene and panic disorder.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12424565 2002 Promoter analysis of human cholecystokinin type-A receptor gene.
12198366 2002 Investigation of quantitative trait loci in the CCKAR gene with susceptibility to alcoholism.
11730982 2001 Cellular expression of CCK-A and CCK-B/gastrin receptors in human gastric mucosa.
11549403 2001 Linked polymorphisms (-333G>T and -286A>G) in the promoter region of the CCK-A receptor gene may be associated with schizophrenia.
11495676 2001 Identification of CCK-B/gastrin receptor splice variants in human peripheral blood mononuclear cells.
11368834 2001 No association of CCK and CCK(B) receptor polymorphisms with alcohol dependence.
11300760 2001 Intermolecular interactions between cholecystokinin-8 and the third extracellular loop of the cholecystokinin A receptor.
10893485 2000 Novel polymorphisms of the human cholecystokinin A receptor gene: an association analysis with schizophrenia.
10682840 2000 Gene structure of human cholecystokinin (CCK) type-A receptor: body fat content is related to CCK type-A receptor gene promoter polymorphism.
10595537 1999 Arginine 197 of the cholecystokinin-A receptor binding site interacts with the sulfate of the peptide agonist cholecystokinin.
10555959 1999 Molecular complex of cholecystokinin-8 and N-terminus of the cholecystokinin A receptor by NMR spectroscopy.
10400673 1999 Arginine 336 and asparagine 333 of the human cholecystokinin-A receptor binding site interact with the penultimate aspartic acid and the C-terminal amide of cholecystokinin.
10026437 1999 Mechanism of cholecystokinin-A- receptor antagonist on human pancreatic exocrine secretion. Localization of CCK-A receptor in the human duodenum.
9603948 1998 Met-195 of the cholecystokinin-A receptor interacts with the sulfated tyrosine of cholecystokinin and is crucial for receptor transition to high affinity state.
9192855 1997 Human cholecystokinin type A receptor gene: cytogenetic localization, physical mapping, and identification of two missense variants in patients with obesity and non-insulin-dependent diabetes mellitus (NIDDM).
9006937 1997 Identification of two amino acids of the human cholecystokinin-A receptor that interact with the N-terminal moiety of cholecystokinin.
8503909 1993 Molecular cloning and functional expression of the human gallbladder cholecystokinin A receptor.
8343165 1993 Molecular cloning, functional expression and chromosomal localization of the human cholecystokinin type A receptor.
7759110 1995 Chromosomal localization of the gastric and brain receptors for cholecystokinin (CCKAR and CCKBR) in human and mouse.
7557108 1995 Abnormal processing of the human cholecystokinin receptor gene in association with gallstones and obesity.