Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.38
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
posterior fossa group A ependymoma 1.500 6.6e-10
glioblastoma 2.000 1.3e-04
group 3 medulloblastoma 2.000 3.3e-03
cystic fibrosis 1.447 1.6e-05
atypical teratoid / rhabdoid tumor 1.400 1.8e-07
medulloblastoma, large-cell -1.200 4.7e-02
primitive neuroectodermal tumor 1.400 9.0e-04
juvenile dermatomyositis 2.017 2.1e-11
acute quadriplegic myopathy 1.094 2.7e-06
pancreatic ductal adenocarcinoma liver m... -1.975 2.2e-03
pediatric high grade glioma 1.700 1.2e-04
pilocytic astrocytoma 1.400 3.2e-04
gastric carcinoma 1.200 1.7e-02
ulcerative colitis 1.100 7.7e-04
ovarian cancer 1.700 1.6e-04
pituitary cancer -2.000 7.7e-04
pancreatic cancer 1.300 1.6e-02

AA Sequence

MRRSMKRRRRRRPVAPATAARGGDFRAEDGAGLEAREEKVVYSRSQLSLADSTKALGDAFKLFMPRSTEF      1 - 70
MSSDAELWSFLCSLKHQFSPHILRSKDVYGYSSCRALVPDPPGPPTARGQARRPVPRAAARRRRRGARAA     71 - 140
AARRRKPRPPPPPPPPPEESCPAKPVAPGPCFGGRTLEEIWRAATPTLTTFPTIRVGSDVWGERSLAAAR    141 - 210
RRARQVLRVNLEPMVRLRRFPVPRA                                                 211 - 235
//

Text Mined References (10)

PMID Year Title
24951662 2014 Sequencing of 2 subclinical atherosclerosis candidate regions in 3669 individuals: Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) Consortium Targeted Sequencing Study.
24108091 2013 A single-molecule long-read survey of the human transcriptome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.