Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.71
PubTator Score 8.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count
Hypospadias 65
Disease Target Count P-value
malignant mesothelioma 3163 5.1e-07
osteosarcoma 7933 5.3e-05
Multiple myeloma 1327 6.4e-03
ovarian cancer 8491 2.0e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.301 6.4e-03
malignant mesothelioma 1.300 5.1e-07
osteosarcoma 1.527 5.3e-05
ovarian cancer 1.100 2.0e-02

Synonym

Accession Q9P031 Q9H2V5 Q9NW62 TTF-1-associated protein 26
Symbols BR22
TAP26
HSPC128

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

AA Sequence

MAPVRRSAKWRPGGIEARGEGVSTVGYRNKNVRQKTWRPNHPQAFVGSVREGQGFAFRRKLKIQQSYKKL      1 - 70
LRKEKKAQTSLESQFTDRYPDNLKHLYLAEEERHRKQARKVDHPLSEQVHQPLLEEQCSIDEPLFEDQCS     71 - 140
FDQPQPEEQCIKTVNSFTIPKKNKKKTSNQKAQEEYEQIQAKRAAKKQEFERRKQEREEAQRQYKKKKME    141 - 210
VFKILNKKTKKGQPNLNVQMEYLLQKIQEKC                                           211 - 241
//

Text Mined References (14)

PMID Year Title
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16630564 2006 The TTF-1/TAP26 complex differentially modulates surfactant protein-B (SP-B) and -C (SP-C) promoters in lung cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12882447 2003 BR22, a 26 kDa thyroid transcription factor-1 associated protein (TAP26), is expressed in human lung cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11152647 2001 BR22, a novel protein, interacts with thyroid transcription factor-1 and activates the human surfactant protein B promoter.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.