Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
non-small cell lung cancer 2890 3.1e-06
ependymoma 4679 6.0e-03
astrocytic glioma 2597 8.9e-03
Disease Target Count Z-score Confidence
Ehrlichiosis 9 4.825 2.4

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytic glioma -1.100 8.9e-03
ependymoma -1.400 6.0e-03
non-small cell lung cancer 1.012 3.1e-06

Gene RIF (1)

AA Sequence

MAAPSGGVNCEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHASRDRV      1 - 70
IKNCIAQTSAVVKNLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWKVFNERCRIHFKP     71 - 140
PKNE                                                                      141 - 144
//

Text Mined References (10)

PMID Year Title