Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.53
PubTator Score 1.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group B ependymoma 416 1.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.8

Expression

  Differential Expression (1)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 1.2e-06

 Compartment GO Term (1)

Gene RIF (3)

AA Sequence

MAFRGPEPWVSASLLRQRLKAEEKTLDLEFEVLSVGFNEAGRYALRLSAENPLQVGSGAGVQLQVNDGDP      1 - 70
FPACSAITDVIEQQEPGQSLTLTRSKFIFTLPKGFCKNDGQHDAQLHVEALRLDEPLGRAAQRVGEAIFP     71 - 140
IYPRPDQPRMNPKAQDHEDLYRYCGNLALLRASTDPTARHCGSLAYSVAFHVHRGPQPPVSDSPPRAGQP    141 - 210
ELMSPEEPLIASQSTEPEIGHLSPSKKETIMVTLHGATNLPACKDGSEPWPYVVVKSTSEEKNNQSSKAV    211 - 280
TSVTSEPTRAPIWGDTVNVEIQAEDAGQEDVILKVVDNRKKQELLSYKIPIKYLRVFHPYHFELVKPTES    281 - 350
GKADEATAKTQLYATVVRKSSFIPRYIGCNHMALEIFLRGVNEPLANNPNPIVVIARVVPNYKEFKVSQA    351 - 420
NRDLASVGLPITPLSFPIPSMMNFDVPRVSQNGCPQLSKPGGPPEQPLWNQSFLFQGRDGATSFSEDTAL    421 - 490
VLEYYSSTSMKGSQPWTLNQPLGISVLPLKSRLYQKMLTGKGLDGLHVERLPIMDTSLKTINDEAPTVAL    491 - 560
SFQLLSSERPENFLTPNNSKALPTLDPKILDKKLRTIQESWSKDTVSSTMDLSTSTPREAEEEPLVPEMS    561 - 630
HDTEMNNYRRAMQKMAEDILSLRRQASILEGENRILRSRLAQQEEEEGQGKASEAQNTVSMKQKLLLSEL    631 - 700
DMKKLRDRVQHLQNELIRKNDREKELLLLYQAQQPQAALLKQYQGKLQKMKALEETVRHQEKVIEKMERV    701 - 770
LEDRLQDRSKPPPLNRQQGKPYTGFPMLSASGLPLGSMGENLPVELYSVLLAENAKLRTELDKNRHQQAP    771 - 840
IILQQQALPDLLSGTSDKFNLLAKLEHAQSRILSLESQLEDSARRWGREKQDLATRLQEQEKGFRHPSNS    841 - 910
IIIEQPSALTHSMDLKQPSELEPLLPSSDSKLNKPLSPQKETANSQQT                          911 - 958
//

Text Mined References (14)

PMID Year Title