Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.22
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 5.2e-08
ependymoma 4679 2.4e-05
medulloblastoma, large-cell 6241 6.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Papillary thyroid carcinoma 43 3.0 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma 1.200 2.4e-05
medulloblastoma, large-cell -1.100 6.3e-03
ovarian cancer 1.200 5.2e-08

Gene RIF (1)

AA Sequence

MSQEKNEMFESEWSKEREREKQLASGLDTAEKALKVESEELQKSKSELICLYNEVHNLPGESESKDHFLI      1 - 70
ACDLLQRENSELETKVLKLSQEFAQLNHFTLGGKTAPSNLITSENTCKDPESNEPILETEIQSRKEETEE     71 - 140
LCPKLGERKQKEIPEESVKEGSFPREGQKEEGSQQNRDMKDEEKEQQLTMKPEEIVRLREELSHINQSLL    141 - 210
QSQSSGDSSDDSGAQHPSSGEKLKYNQQGEVQQLHQNLHRLQILCNSAENELRYERGQNLDLKQHNSLLQ    211 - 280
EENIKIKIELKHAQQKLLDSTKMCSSLTAEYKHCQQKIKELELEVLKHTQSIKSQNNLQEKLVQEKSKVA    281 - 350
DAEEKILDLQRKLEHAHKVCLTDTCISEKQQLEEKIKEATQNEAKVKQQYQEEQQKRKLLYQNVDELHRQ    351 - 420
VRTLQDKENLLEMTCSQQQSRIQQQEALLKQLENEKRKYDEHVKSNQELSEKLSKLQQEKEALREEYLRL    421 - 490
LKLLNVHVRNYNEKHHQQKVKLQKVKYRLTNEVELRDKRINQFEDEIGILQHKIEKEKAIQDQITAQNDT    491 - 560
LLLEKRKLQEQVIEQEQLIHSNKWTISSIQSRVLYMDKENKQLQENSLRLTQQIGFLERIIRSIHIRRGE    561 - 630
NLKEFPVPKWWHRGKLASLPPTKKQKEIYSTEVFTSNNAELQHEDESVPEATEKWKHSEQMETTISDILE    631 - 700
SEVVNEILPLSNSSFSGKGLVESFASLQETEEIKSKEAMASSKSPEKSPENLVCSQNSEAGYINVASLKE    701 - 770
THGIQEQDQKSEL                                                             771 - 783
//

Text Mined References (3)

PMID Year Title