Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 2.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 4.1e-03
astrocytic glioma -1.500 1.4e-02
atypical teratoid / rhabdoid tumor -1.300 2.5e-03
glioblastoma -1.500 3.9e-05
medulloblastoma, large-cell -1.800 1.9e-05
oligodendroglioma -1.700 2.2e-02
osteosarcoma -1.496 4.1e-05
ovarian cancer -2.600 8.8e-14
primitive neuroectodermal tumor -1.100 5.3e-03

 Compartment GO Term (2)

Gene RIF (1)

AA Sequence

MPRAEPRATLGEQEKAGLPLGAWRLYLLRHFRKQTELRRSGSRDVTGALLVAAAVASEAVGSLRVAEGGP      1 - 70
NTLLLQVLRSWPWCNKELKTMEERKVKRRSPKSFSAHCTQVVNAKKNAIPVSKSTGFSNPASQSTSQRPK     71 - 140
LKRVMKEKTKPQGGEGKGAQSTPIQHSFLTDVSDVQEMERGLLSLLNDFHSGKLQAFGNECSIEQMEHVR    141 - 210
GMQEKLARLNLELYGELEELPEDKRKTASDSNLDRLLSDLEELNSSIQKLHLADAQDVPNTSAS          211 - 274
//

Text Mined References (7)

PMID Year Title