Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 416 3.7e-08
osteosarcoma 7950 8.8e-08
breast carcinoma 1638 6.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.100 6.3e-03
osteosarcoma -2.903 8.8e-08
posterior fossa group B ependymoma 1.400 3.7e-08

 Compartment GO Term (1)

AA Sequence

MLNRKTSHFLGMRVQSELEHLSELRREAGKDRSSVHGSAARTRASVRTQWTTAAAAKADEDPGANLFPPP      1 - 70
LPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQ     71 - 140
TSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVRRPPFSIDLFKEEQLLALEDYVVNTYFRHFK    141 - 210
LYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRA    211 - 280
YIKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPGKGKSKTK                       281 - 331
//

Text Mined References (3)

PMID Year Title