Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.7e-08
osteosarcoma 7933 8.8e-08
breast carcinoma 1614 6.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.903 8.8e-08
breast carcinoma 1.100 6.3e-03
posterior fossa group B ependymoma 1.400 3.7e-08

AA Sequence

MLNRKTSHFLGMRVQSELEHLSELRREAGKDRSSVHGSAARTRASVRTQWTTAAAAKADEDPGANLFPPP      1 - 70
LPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAITLDLFCHALIFCRQQGFSLEQ     71 - 140
TSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVRRPPFSIDLFKEEQLLALEDYVVNTYFRHFK    141 - 210
LYKYVFTPQVRLDLSLTYMGLQPPKLWPESETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRA    211 - 280
YIKTQVNKELEQLQGLVEERLKASEERLSSKLTALERPFQLPPGKGKSKTK                       281 - 331
//

Text Mined References (3)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.