Property Summary

NCBI Gene PubMed Count 29
PubMed Score 7.80
PubTator Score 7.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
lung carcinoma 2843 1.2e-06
colon cancer 1478 2.5e-02
ependymoma 4679 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Breast cancer 3578 3.281 1.6
Myeloid Leukemia 19 0.0 1.4
Osteoporosis 363 0.0 3.0
Disease Target Count
ESTROGEN RESISTANCE 2

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.400 2.5e-02
ependymoma 2.200 4.9e-02
lung carcinoma -1.600 1.2e-06

Synonym

Accession Q8IYT3 Q5VXB7 Q6P9E4 Q96KA9 Q9H5M3
Symbols C6orf97
bA282P11.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MSLDCTSHIALGAASPAPEETYDHLSEVPVTREQLNHYRNVAQNARSELAATLVKFECAQSELQDLRSKM      1 - 70
LSKEVSCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKIRTEITAHAAIKENQELKKKV     71 - 140
VELNEKLQKCSKENEENKKQVSKNCRKHEEFLTQLRDCLDPDERNDKASDEDLILKLRDLRKENEFVKGQ    141 - 210
IVILEETINVHEMEAKASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQER    211 - 280
LLAGQQVWDASKQEVSLLKKSSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILE    281 - 350
KIREMDSREESRDRMVSQLEAQISELVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGV    351 - 420
LRDNLNFEKQKYLKFLDQLSQKMKLDQMAAELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKL    421 - 490
KTQKERLESKELHMSLLRQKIAQLEEEKQARTALVVERDNAHLTIRNLQKKVERLQKELNTCRDLHTELK    491 - 560
AKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKKLMSVKSELDTTEHEAKENKERARNMIEVVT    561 - 630
SEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEIIKCLERLVHSHQHHFVTCACLKDVT    631 - 700
TGQERHPQGHLQLLH                                                           701 - 715
//

Text Mined References (29)

PMID Year Title