Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.30
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (1)

AA Sequence

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFL      1 - 70
RQENRKNMLLSVAIFILLTLVYAYWTM                                                71 - 97
//

Text Mined References (8)

PMID Year Title