Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.11

Knowledge Summary


No data available


  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.7


  Differential Expression (3)

Disease log2 FC p
cystic fibrosis and chronic rhinosinusit... -1.064 4.7e-02
ependymoma 1.500 5.3e-08
facioscapulohumeral dystrophy 2.200 4.4e-04

Gene RIF (3)

AA Sequence

LHRTLYAKEILPKISPQKPPRKDMESTVFKI                                           561 - 591

Text Mined References (10)

PMID Year Title