Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.50
PubTator Score 3.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.300 6.9e-03
ependymoma -1.100 2.7e-02
glioblastoma -1.100 1.7e-03
group 4 medulloblastoma -1.200 7.8e-03
intraductal papillary-mucinous adenoma (... -3.100 1.7e-04
intraductal papillary-mucinous carcinoma... -3.200 2.5e-04
intraductal papillary-mucinous neoplasm ... -2.900 4.8e-03
oligodendroglioma -1.100 1.7e-02
pancreatic cancer -1.700 6.0e-04
pituitary cancer -1.200 2.9e-03
psoriasis -1.100 5.5e-16

Gene RIF (1)

AA Sequence

MSPEKQHREEDEVDSVLLSASKILNSSEGVKESGCSDTEYGCIAESENQIQPQSALKVLQQQLESFQALR      1 - 70
MQTLQNVSMVQSEISEILNKSIIEVENPQFSSEKNLVFGTRIEKDLPTENQEENLSMEKSHHFEDSKTLH     71 - 140
SVEEKLSGDSVNSLPQSVNVPSQIHSEDTLTLRTSTDNLSSNIIIHPSENSDILKNYNNFYRFLPTAPPN    141 - 210
VMSQADTVILDKSKITVPFLKHGFCENLDDICHSIKQMKEELQKSHDGEVALTNELQTLQTDPDVHRNGK    211 - 280
YDMSPIHQDKMNFIKEENLDGNLNEDIKSKRISELEALVKKLLPFRETVSKFHVHFCRKCKKLSKSEMHR    281 - 350
GKKNEKNNKEIPITGKNITDLKFHSRVPRYTLSFLDQTKHEMKDKERQPFLVKQGSIISENEKTSKVNSV    351 - 420
TEQCVAKIQYLQNYLKESVQIQKKVMELESENLNLKSKMKPLIFTTQSLIQKVETYEKQLKNLVEEKSTI    421 - 490
QSKLSKTEEYSKECLKEFKKIISKYNVLQGQNKTLEEKNIQLSLEKQQMMEALDQLKSKEHKTQSDMAIV    491 - 560
NNENNRMSIEMEAMKTNILLIQDEKEMLEKKTHQLLKEKSSLGNELKESQLEIIQLKEKERLAKTEQETL    561 - 630
LQIIETVKDEKLNLETTLQESTAARQIMEREIENIQTYQSTAEENFLQEIKNAKSEASIYKNSLSEIGKE    631 - 700
CEMLSKMVMETKTDNQILKEELKKHSQENIKFENSISRLTEDKILLENYVRSIENERDTLEFEMRHLQRE    701 - 770
YLSLSDKICNQHNDPSKTTYISRREKFHFDNYTHEDTSSPQSRPLASDLKGYFKVKDRTLKHH           771 - 833
//

Text Mined References (7)

PMID Year Title