Property Summary

NCBI Gene PubMed Count 70
PubMed Score 5.68
PubTator Score 203.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.496 1.1e-02
osteosarcoma 1.507 1.5e-02
ependymoma 1.100 5.5e-06
glioblastoma 1.500 7.7e-04
atypical teratoid / rhabdoid tumor 1.300 6.0e-06
medulloblastoma 1.200 1.8e-04
medulloblastoma, large-cell 1.400 4.4e-05
juvenile dermatomyositis 1.152 2.1e-12
Amyotrophic Lateral Sclerosis 1.035 2.6e-07
acute quadriplegic myopathy 1.557 1.1e-07
pediatric high grade glioma 1.200 5.0e-04
pilocytic astrocytoma 1.200 2.7e-06
ulcerative colitis 1.500 1.2e-06
ovarian cancer 2.200 6.9e-04
Down syndrome 1.600 7.5e-04

Protein-protein Interaction (3)

MLP Assay (15)

AID Type Active / Inconclusive / Inactive Description
1434 confirmatory 1621 / 0 / 216765 uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a fluorescence resonance energy transfer (FRET) assay.
1438 confirmatory 45 / 0 / 2179 Identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1496 screening 993 / 0 / 214825 uHTS identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb via a fluorescence resonance energy transfer (FRET) assay.
1502 screening 75 / 0 / 400 Identification of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1550 confirmatory 4 / 0 / 2 Confirmation of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a time resolved fluorescence resonance energy transfer (TR-FRET) assay.
1560 confirmatory 9 / 0 / 4 Confirmation of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC via a fluorescence resonance energy transfer (FRET) assay
1639 summary 0 / 0 / 0 Summary of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb
1645 summary 0 / 0 / 0 Summary of compounds inhibiting the binding between the RUNX1 Runt domain and CBFb-SMMHC
504370 confirmatory 24 / 33 / 82 qHTS Assay for Compounds Blocking the Interaction Between CBF-beta and RUNX1 for the Treatment of Acute Myeloid Leukemia: ME-1 cellular proliferation
504371 confirmatory 4 / 1 / 1 qHTS Assay for Compounds Blocking the Interaction Between CBF-beta and RUNX1 for the Treatment of Acute Myeloid Leukemia: ME-1 cellular proliferation, SAR for Probe
More...

Gene RIF (79)

PMID Text
26418744 Thus, an NGF/TrkA-MAPK-CBFbeta pathway converges with Islet1-Runx1 signaling to promote Runx1/CBFbeta holocomplex formation and nonpeptidergic nociceptor maturation.
26241003 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
26163765 Our findings demonstrate that HSPCs exposed to non-cytotoxic levels of environmental chemicals and chemotherapeutic agents are prone to topoisomerase II-mediated DNA damage at the leukemia-associated genes MLL and CBFB.
25981045 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25912140 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25901786 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25582776 CBF-beta promoted steady-state levels of HIV-1 Vif by inhibiting the degradation of HIV-1 Vif through the proteasome pathway.
25582776 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25424878 These results provide important information on the assembly of the Vif-CUL5-E3 ubiquitin ligase and identify a new viV binding interface with CBF-beta at the C-terminus of HIV-1 Vif.
25424878 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25408426 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25266220 we report a novel hypomethylation pattern, specific to CBFB-MYH11 fusion resulting from inv(16) rearrangement in acute myeloid leukemia the expression of which correlated with PBX3 differential methylation
25206352 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25142583 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25124760 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25122780 suggest that a different mechanism exists for the Vif-APOBEC interaction and that non-primates are not suitable animal models for exploring pharmacological interventions that disrupt Vif-CBF-beta interaction
25122780 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
25079347 CBFB contributes to the transcriptional regulation of ribosomal gene expression and provide further understanding of the epigenetic role of CBFB-SMMHC in proliferation and maintenance of the leukemic phenotype.
24810617 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24651404 Our findings indicate that RUNX1 and CBF-beta cooperate in cells to modulate HIV-1 replication
24648201 Suggest that CBFbeta retention in the midbody during cytokinesis reflects a novel function that contributes to epigenetic control.
24522927 Authors propose that CBFbeta acts as a chaperone to stabilize HIV-1 Vif during and after synthesis and to facilitate interaction of Vif with cellular cofactors required for the efficient degradation of APOBEC3G.
24522927 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24418540 Vif conserved residues E88/W89 are crucial for CBFbeta binding.
24418540 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24402281 data reveal the structural basis for Vif hijacking of the CBF-beta and CUL5 E3 ligase complex, laying a foundation for rational design of novel anti-HIV drugs
24402281 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24402277 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24390335 CBF-beta is critical for the formation of the Vif-ElonginB/ElonginC-Cul5 core E3 ubiquitin ligase complex.
24390335 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24390320 In the absence of CBFbeta, Vif does not bind Cul5, thus preventing the assembly of the E3 ligase complex.
24390320 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24352440 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24189052 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
24002588 Transcriptional analysis revealed that upon fusion protein knockdown, a small subset of the CBFbeta-MYH11 target genes show increased expression, confirming a role in transcriptional repression
23988114 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
23878140 This report of recurring FLT3 N676 mutations in core-binding factor (CBF) leukemias suggests a defined subgroup of CBF leukemias.
23430691 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
23333304 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
23300442 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
23175372 Authors revealed that different lengths and regions are required for CBFbeta to assist HIV-1 Vif or RUNX1.
23175372 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
23160462 We conclude that non-type A CBFB-MYH11 fusion types associate with distinct clinical and genetic features, including lack of KIT mutations, and a unique gene-expression profile in acute myeloid leukemia
23152542 Our data indicate that the CBFbeta-SMMHC's C-terminus is essential to induce embryonic hematopoietic defects and leukemogenesis.
23098073 A comparison of heat capacity changes supports a model in which CBFbeta prestabilizes Vif((1-192)) relative to Vif((95-192))
23098073 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22725134 These separation-of-function mutants demonstrate that HIV-1 Vif and the RUNX transcription factors interact with cellular CBFbeta on genetically distinct surfaces.
22725134 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22479405 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22205746 Vif proteins of human and simian immunodeficiency viruses require cellular CBFbeta to degrade APOBEC3G.
22205746 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22190037 CBF-beta is required for Vif-mediated degradation of APOBEC3G and therefore for preserving HIV-1 infectivity
22190037 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22190037 Knockdown of core-binding factor, beta subunit (CBFB) by siRNA/shRNA inhibits HIV-1 replication in 293T cells
22190036 Vif and CBF-beta physically interact, and that the amino-terminal region of Vif is required for this interaction
22190036 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
22190036 Knockdown of core-binding factor, beta subunit (CBFB) by siRNA/shRNA inhibits HIV-1 replication in 293T cells
22190034 HIV-1 Vif interacts with CBFB as demonstrated by co-immunoprecipitation assay
20607802 Data collectively suggest that CBFbeta is required for malignant phenotype in prostate and ovarian cancer cells.
20591170 conclude that CBFbeta is required for a subset of Runx2-target genes that are sufficient to maintain the invasive phenotype of the cells
20433876 The expression of Cbfbeta which were the key factors in osteogenic differentiation was also up-regulated.
20306685 Studies show that FISH technic for the detection of CBF chromosomal aberrations was significantly higher than conventional cytogenetics.
20306249 The structural features of RUNX1/CBFbeta and their derivatives, their roles in transcriptional control, and their contributions to normal and malignant hematopoiesis are discussed. Review.
20225274 Loss of DNA binding, but not nuclear localization or CBF-beta heterodimerization, causes RUNX2 haploinsufficiency in patients with the RUNX2(R131G) mutation.
19603346 For routine clinical practice, it may be meaningful to screen for C-KIT mutations in AML1/ETO-positive patients, as well as for FLT3(D835) mutations in CBF-AML.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19179469 CBFbeta is essential for TEL-AML1's ability to promote self-renewal of B cell precursors in vitro.
19156145 high CBFB protein level was an independent predictor of survival in colorectal cancer
18695000 interaction with PEBP2-beta leads to the phosphorylation of RUNX1, which in turn induces p300 phosphorylation
17571080 Examine consequences of expression of abnormal chimeric protein CBFbeta-MYH11 in acute myelomonocytic leukemia.
17379770 Cbfb enhances osteogenic differentiation of mesenchymal stem cells by stabilizing Cbfa-1 proteins.
17287858 Rare fusion transcripts were correlated with an atypical cytomorphology not primarily suggestive for the FAB subtype acute myelocytic leukemia.
16767164 Agents interacting with the outer surface of the CBFbeta-SMMHC ACD that prevent multimerization may be effective as novel therapeutics in AML
16504290 These observations suggest that when abdominal GS is diagnosed, an analysis of the CBFB/MYH11 fusion gene is necessary to make an appropriate decision regarding treatment options, even if no chromosomal abnormalities are found.
16502584 Detection of acute myeloid leukemic cells that are characterized by a CBFB-MYH11 gene fusion.
15585652 Plag1 and Plagl2 are novel leukemia oncogenes that act by expanding hematopoietic progenitors expressing CbF beta-SMMHC.
15386419 Expression of CBFB is down regulated in a significant portion of gastric cancer cases; may be involved in gastric carcinogenesis
12495904 review: genetics of CBFB and RUNX1 and roles in hematopoiesis and leukemogenesis, with emphasis on human and knockout mice studies
12239155 has a role in hematopoiesis; preturbations result from expression of the leukemogenic fusion gene Cbfb-MYH11

AA Sequence

MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVATGTNLSLQFFP      1 - 70
ASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLDGMGCLEFDEERAQQEDALAQ     71 - 140
QAFEEARRRTREFEDRDRSHREEMEVRVSQLLAVTGKKTTRP                                141 - 182
//

Text Mined References (78)

PMID Year Title
26418744 2015 Extrinsic and intrinsic signals converge on the Runx1/CBF? transcription factor for nonpeptidergic nociceptor maturation.
26163765 2015 Environmental and chemotherapeutic agents induce breakage at genes involved in leukemia-causing gene rearrangements in human hematopoietic stem/progenitor cells.
25582776 2015 Multiple lysines combined in HIV-1 Vif determines the responsiveness to CBF-?.
25424878 2014 Requirement of HIV-1 Vif C-terminus for Vif-CBF-? interaction and assembly of CUL5-containing E3 ligase.
25266220 2014 CBFB-MYH11 hypomethylation signature and PBX3 differential methylation revealed by targeted bisulfite sequencing in patients with acute myeloid leukemia.
25122780 2014 Core-binding factor subunit beta is not required for non-primate lentiviral Vif-mediated APOBEC3 degradation.
25079347 2014 CBF? and the leukemogenic fusion protein CBF?-SMMHC associate with mitotic chromosomes to epigenetically regulate ribosomal genes.
24651404 2014 Activation of HIV-1 from latent infection via synergy of RUNX1 inhibitor Ro5-3335 and SAHA.
24648201 2014 Core binding factor ? (CBF?) is retained in the midbody during cytokinesis.
24522927 2014 CBF? enhances de novo protein biosynthesis of its binding partners HIV-1 Vif and RUNX1 and potentiates the Vif-induced degradation of APOBEC3G.
24418540 2014 Defining HIV-1 Vif residues that interact with CBF? by site-directed mutagenesis.
24402281 2014 Structural basis for hijacking CBF-? and CUL5 E3 ligase complex by HIV-1 Vif.
24390335 2014 Evolutionarily conserved requirement for core binding factor beta in the assembly of the human immunodeficiency virus/simian immunodeficiency virus Vif-cullin 5-RING E3 ubiquitin ligase.
24390320 2014 Core binding factor beta plays a critical role by facilitating the assembly of the Vif-cullin 5 E3 ubiquitin ligase.
24002588 2014 CBFB-MYH11/RUNX1 together with a compendium of hematopoietic regulators, chromatin modifiers and basal transcription factors occupies self-renewal genes in inv(16) acute myeloid leukemia.
23878140 2013 Exome sequencing identifies recurring FLT3 N676K mutations in core-binding factor leukemia.
23175372 2013 Differential requirements for HIV-1 Vif-mediated APOBEC3G degradation and RUNX1-mediated transcription by core binding factor beta.
23160462 2013 inv(16)/t(16;16) acute myeloid leukemia with non-type A CBFB-MYH11 fusions associate with distinct clinical and genetic features and lack KIT mutations.
23152542 2013 The C-terminus of CBF?-SMMHC is required to induce embryonic hematopoietic defects and leukemogenesis.
23098073 2012 Core-binding factor ? increases the affinity between human Cullin 5 and HIV-1 Vif within an E3 ligase complex.
22725134 2012 HIV type 1 viral infectivity factor and the RUNX transcription factors interact with core binding factor ? on genetically distinct surfaces.
22205746 2012 Vif proteins of human and simian immunodeficiency viruses require cellular CBF? to degrade APOBEC3 restriction factors.
22190037 2011 Vif hijacks CBF-? to degrade APOBEC3G and promote HIV-1 infection.
22190036 2011 T-cell differentiation factor CBF-? regulates HIV-1 Vif-mediated evasion of host restriction.
22190034 2011 Global landscape of HIV-human protein complexes.
21269460 2011 Initial characterization of the human central proteome.
20607802 2010 Association of core-binding factor ? with the malignant phenotype of prostate and ovarian cancer cells.
20591170 2010 The Runx transcriptional co-activator, CBFbeta, is essential for invasion of breast cancer cells.
20433876 2010 Osteogenic differentiation of bone marrow mesenchymal stem cells by adenovirus-mediated expression of leptin.
20306685 2008 Dual color FISH on CBF primary acute myeloid leukemia.
20306249 2010 Proleukemic RUNX1 and CBFbeta mutations in the pathogenesis of acute leukemia.
20225274 2010 The cleidocranial dysplasia-related R131G mutation in the Runt-related transcription factor RUNX2 disrupts binding to DNA but not CBF-beta.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19603346 2009 Monitoring of minimal residual disease in patients with core binding factor acute myeloid leukemia and the impact of C-KIT, FLT3, and JAK2 mutations on clinical outcome.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19179469 2009 CBFbeta is critical for AML1-ETO and TEL-AML1 activity.
19156145 2009 Dysregulation of the transcription factors SOX4, CBFB and SMARCC1 correlates with outcome of colorectal cancer.
18695000 2008 PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17571080 2007 Comparative analysis of genes regulated in acute myelomonocytic leukemia with and without inv(16)(p13q22) using microarray techniques, real-time PCR, immunohistochemistry, and flow cytometry immunophenotyping.
17431401 2007 Cdk6 blocks myeloid differentiation by interfering with Runx1 DNA binding and Runx1-C/EBPalpha interaction.
17379770 2007 Cbfb enhances the osteogenic differentiation of both human and mouse mesenchymal stem cells induced by Cbfa-1 via reducing its ubiquitination-mediated degradation.
17287858 2007 Rare CBFB-MYH11 fusion transcripts in AML with inv(16)/t(16;16) are associated with therapy-related AML M4eo, atypical cytomorphology, atypical immunophenotype, atypical additional chromosomal rearrangements and low white blood cell count: a study on 162 patients.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16767164 2006 Identification of a region on the outer surface of the CBFbeta-SMMHC myeloid oncoprotein assembly competence domain critical for multimerization.
16504290 2006 Granulocytic sarcoma of mesentery in acute myeloid leukemia with CBFB/MYH11 fusion gene but not inv(16) chromosome: case report and review of literature.
16502584 2006 Diagnosis and monitoring of CBFB-MYH11-positive acute myeloid leukemia by qualitative and quantitative RT-PCR.
15585652 2005 Plag1 and Plagl2 are oncogenes that induce acute myeloid leukemia in cooperation with Cbfb-MYH11.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15386419 2005 Frequent downregulation of the runt domain transcription factors RUNX1, RUNX3 and their cofactor CBFB in gastric cancer.
15138260 2004 Transforming growth factor-beta stimulates p300-dependent RUNX3 acetylation, which inhibits ubiquitination-mediated degradation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12495904 2002 Core binding factor genes and human leukemia.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12434156 2002 Cbfbeta interacts with Runx2 and has a critical role in bone development.
12239155 2002 Role of Cbfb in hematopoiesis and perturbations resulting from expression of the leukemogenic fusion gene Cbfb-MYH11.
12217689 2002 The RUNX1 Runt domain at 1.25A resolution: a structural switch and specifically bound chloride ions modulate DNA binding.
11276260 2001 The leukemia-associated AML1 (Runx1)--CBF beta complex functions as a DNA-induced molecular clamp.
10958941 2000 A unique structural abnormality of chromosome 16 resulting in a CBF beta-MYH11 fusion transcript in a patient with acute myeloid leukemia, FAB M4.
10914550 2000 The PEBP2beta/CBF beta-SMMHC chimeric protein is localized both in the cell membrane and nuclear subfractions of leukemic cells carrying chromosomal inversion 16.
10856244 2000 Structural basis for the heterodimeric interaction between the acute leukaemia-associated transcription factors AML1 and CBFbeta.
10536006 1999 The inv(16) encodes an acute myeloid leukemia 1 transcriptional corepressor.
10404215 1999 Molecular insights into PEBP2/CBF beta-SMMHC associated acute leukemia revealed from the structure of PEBP2/CBF beta.
9751756 1998 The PEBP2betaMYH11 fusion created by Inv(16)(p13;q22) in myeloid leukemia impairs neutrophil maturation and contributes to granulocytic dysplasia.
9447981 1998 The AML1-MTG8 leukemic fusion protein forms a complex with a novel member of the MTG8(ETO/CDR) family, MTGR1.
9264408 1997 The protooncogene product, PEBP2beta/CBFbeta, is mainly located in the cytoplasm and has an affinity with cytoskeletal structures.
9191054 1997 Differentiation dependent expression and distinct subcellular localization of the protooncogene product, PEBP2beta/CBFbeta, in muscle development.
9064279 1996 Structure of the leukemia-associated human CBFB gene.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8351518 1993 Fusion between transcription factor CBF beta/PEBP2 beta and a myosin heavy chain in acute myeloid leukemia.
7622058 1995 Cloning, mapping and expression of PEBP2 alpha C, a third gene encoding the mammalian Runt domain.
7607682 1995 Structure of the leukemia-associated human CBFB gene.
7587111 1994 Acute myeloid leukemia with Inv (16) produces a chimeric transcription factor with a myosin heavy chain tail.
2845103 1988 Structure of the complex of adenylate kinase from Escherichia coli with the inhibitor P1,P5-di(adenosine-5'-)pentaphosphate.