Property Summary

Ligand Count 9
NCBI Gene PubMed Count 19
PubMed Score 22.87
PubTator Score 9.06

Knowledge Summary

Patent (4,542)

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -1.326 1.1e-02
adult high grade glioma -1.600 6.4e-03
Astrocytoma, Pilocytic -1.400 6.8e-04
atypical teratoid / rhabdoid tumor -1.800 1.6e-04
ependymoma -1.200 1.5e-04
glioblastoma -1.500 3.0e-04
head and neck cancer -1.100 4.6e-02
interstitial lung disease 1.100 5.3e-03
intraductal papillary-mucinous adenoma (... 1.400 2.6e-04
lung carcinoma 1.400 1.2e-21
medulloblastoma, large-cell -1.900 1.5e-03
osteosarcoma -3.708 9.0e-11
ovarian cancer -1.700 1.9e-13

Gene RIF (3)

AA Sequence

MAAYQQEEQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIK      1 - 70
PQRIEQISHAQRLLSRLHVRCSQRPPLSLWAGWVLECPLFKNFIIFLVFLNTIILMVEIELLESTNTKLW     71 - 140
PLKLTLEVAAWFILLIFILEILLKWLSNFSVFWKSAWNVFDFVVTMLSLLPEVVVLVGVTGQSVWLQLLR    141 - 210
ICRVLRSLKLLAQFRQIQIIILVLVRALKSMTFLLMLLLIFFYIFAVTGVYVFSEYTRSPRQDLEYHVFF    211 - 280
SDLPNSLVTVFILFTLDHWYALLQDVWKVPEVSRIFSSIYFILWLLLGSIIFRSIIVAMMVTNFQNIRKE    281 - 350
LNEEMARREVQLKADMFKRQIIQRRKNMSHEALTSSHSKIEDSSRGASQQRESLDLSEVSEVESNYGATE    351 - 420
EDLITSASKTEETLSKKREYQSSSCVSSTSSSYSSSSESRFSESIGRLDWETLVHENLPGLMEMDQDDRV    421 - 490
WPRDSLFRYFELLEKLQYNLEERKKLQEFAVQALMNLEDK                                  491 - 530
//

Text Mined References (21)

PMID Year Title