Property Summary

Ligand Count 1
NCBI Gene PubMed Count 56
PubMed Score 73.68
PubTator Score 75.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 12 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Congenital ichthyosiform erythroderma 28 0.0 5.0
Disease Target Count Z-score Confidence
Type 1 diabetes mellitus 17 2 4.156 2.1
Atopic dermatitis 952 4.014 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.6e-03

Gene RIF (39)

AA Sequence

MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQ      1 - 70
AIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPG     71 - 140
ETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVT    141 - 210
RRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ                                          211 - 242
//

Text Mined References (58)

PMID Year Title