Property Summary

NCBI Gene PubMed Count 54
PubMed Score 72.36
PubTator Score 75.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.200 1.6e-03

Gene RIF (38)

PMID Text
25651379 overexpression of S100A7 in A431 skin squamous carcinoma cells significantly promoted cell proliferation in vitro and tumor growth in vivo, whereas it suppressed the expression of GATA-3 and caspase-14
25315296 Caspase-14 was decreased in inflammatory lesions compared to non-lesion in atopic dermatitis. The amount of caspase-14 in the lesions correlated with clinical severity as determined by eczema area and severity index score and the skin barrier functions.
25121097 caspase-14 contributes to retinal pigment epithelium cell barrier disruption under hyperglycemic conditions.
24872419 Mesotrypsin generated saposins A-D from prosaposin, and mature caspase-14 contributed to this process by activating mesotrypsinogen to mesotrypsin. Knockdown of these proteases markedly down-regulated saposin A synthesis in skin equivalent models.
23645350 partial loss of caspase 14 is not associated with dedifferentiation in neoplastic lesions of the oral mucosa
23580611 Results suggest that caspase-14 may interact with GCM1 to participate in syncytiotrophoblast differentiation during placental development.
23408445 genetic polymorphisms in AICDA and CASP14 are associated with risk for brain tumor in Korean children.
23377137 Suggest caspase-14 is a marker of human skin differentiation during development.
23362869 ceramides, an important structural lipid, stimulate caspase-14 expression, coordinating formation of lipid lamellar membranes with the formation of corneocytes
22876114 Caspase-14 might play a significant role in the pathogenesis of diabetic retinopathy by accelerating retinal endothelial and epithelial cells death.
22825846 regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14.
22548721 genetic polynorphism is associated with the risk of childhood leukemia
21930782 A strong association was evident between GATA-3 and caspase-14 expression in preinvasive ductal carcinoma in situ samples, where GATA-3 also displayed prognostic significance
21567094 Casp-14 overexpression correlated with tumor stage, cell differentiation and lymphovascular involvement, suggesting that casp-14 was associated with tumor cell growth and metastatic potential.
21539619 Regulation of caspase 14 levels provides a possible link between impaired skin barrier function and inflammatory reactions in skin diseases such as atopic dermatitis and may offer an explanation to the skin barrier dysfunction in inflamed skin lesions.
20533828 Caspase 14 is a cysteine protease and is inhibited by full-length LEKTI and 5 recombinant fragments of LEKTI to varied extents.
20402676 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19960512 Purification and characterization of active caspase-14 from human epidermis and development of the cleavage site-directed antibody
19773279 Observational study of gene-disease association. (HuGE Navigator)
19747408 Results imply that caspase-14 inhibits trophoblast differentiation.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19414860 Observational study of gene-disease association. (HuGE Navigator)
19269008 Observational study of gene-disease association. (HuGE Navigator)
18762957 Expression of caspase 6 and caspase 14 genes were different between normal skin of keloid-prone individuals and normal skin of keloid-resistant patients.
18424262 These data reveal the basic organization of the human caspase-14 promoter and suggest an important role of AP-1 and NFkappaB in the transcriptional control of caspase-14.
17558860 Observational study of gene-disease association. (HuGE Navigator)
17558860 caspase-14 gene is rarely mutated in colorectal carcinomas, but not mutated in gastric, lung, breast and hepatocellular carcinomas
17436577 Expression of exogenous caspase-14 led to growth inhibition and reduced the tumorigenicity of A431 skin cancer cells.
17359582 caspase-14 is up-regulated during trophoblast differentiation, as represented by the BeWo cell line
16854378 caspase-14 has a substrate specificity similar to the group I caspases, and demonstrate that it functions in a distinct manner from executioner caspases to carry out specific proteolytic events during keratinocyte differentiation.
16168224 Caspase-14 is present in the human placenta, primarily in the trophoblast, but its function is not clear
16061862 there are tumor-specific alterations in caspase-14 expression which may define subsets of epithelial cancers with distinct clinical behaviors
16061209 caspase-14 is aberrantly expressed in epithelial tumors
15619438 psoriatic keratinocytes may activate mechanisms that prevent the nuclear entry of caspase 14
15331408 Loss of caspase-14 expression is associated with psoriatic lesions
12445205 caspase-14, similarly to other keratinocyte differentiation-associated proteins, is downregulated by retinoids, suggesting that this caspase plays a part in terminal keratinocyte differentiation and skin barrier formation
12200134 processing of caspase 14 in epidermal differentiation

AA Sequence

MSNPRSLEEEKYDMSGARLALILCVTKAREGSEEDLDALEHMFRQLRFESTMKRDPTAEQFQEELEKFQQ      1 - 70
AIDSREDPVSCAFVVLMAHGREGFLKGEDGEMVKLENLFEALNNKNCQALRAKPKVYIIQACRGEQRDPG     71 - 140
ETVGGDEIVMVIKDSPQTIPTYTDALHVYSTVEGYIAYRHDQKGSCFIQTLVDVFTKRKGHILELLTEVT    141 - 210
RRMAEAELVQEGKARKTNPEIQSTLRKRLYLQ                                          211 - 242
//

Text Mined References (56)

PMID Year Title
25651379 2015 S100A7 acts as a dual regulator in promoting proliferation and suppressing squamous differentiation through GATA-3/caspase-14 pathway in A431 cells.
25416956 2014 A proteome-scale map of the human interactome network.
25315296 2014 Pyrrolidone carboxylic acid levels or caspase-14 expression in the corneocytes of lesional skin correlates with clinical severity, skin barrier function and lesional inflammation in atopic dermatitis.
25121097 2014 Caspase-14 expression impairs retinal pigment epithelium barrier function: potential role in diabetic macular edema.
24872419 2014 Mesotrypsin and caspase-14 participate in prosaposin processing: potential relevance to epidermal permeability barrier formation.
24743736 2014 Multiple pathways are involved in DNA degradation during keratinocyte terminal differentiation.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23645350 2013 Expression of caspase 14 and filaggrin in oral squamous carcinoma.
23580611 2013 Caspase-14 suppresses GCM1 acetylation and inhibits placental cell differentiation.
23408445 2013 Genetic variants of AICDA/CASP14 associated with childhood brain tumor.
23377137 2013 Expression of caspase-14 and keratin-19 in the human epidermis and appendages during fetal skin development.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362869 2013 Ceramides stimulate caspase-14 expression in human keratinocytes.
22876114 2012 Caspase-14: a novel caspase in the retina with a potential role in diabetic retinopathy.
22825846 2012 Kallikrein-related peptidase-7 regulates caspase-14 maturation during keratinocyte terminal differentiation by generating an intermediate form.
22548721 2012 Association between CASP7 and CASP14 genetic polymorphisms and the risk of childhood leukemia.
21930782 2011 Gata-3 negatively regulates the tumor-initiating capacity of mammary luminal progenitor cells and targets the putative tumor suppressor caspase-14.
21567094 2011 Caspase-14 is an anti-apoptotic protein targeting apoptosis-inducing factor in lung adenocarcinomas.
21539619 2011 Regulation of caspase 14 expression in keratinocytes by inflammatory cytokines--a possible link between reduced skin barrier function and inflammation?
20533828 2010 New role for LEKTI in skin barrier formation: label-free quantitative proteomic identification of caspase 14 as a novel target for the protease inhibitor LEKTI.
20402676 2010 Mutational analysis of caspase genes in prostate carcinomas.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19960512 2010 Purification and characterization of active caspase-14 from human epidermis and development of the cleavage site-directed antibody.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19747408 2009 Function of caspase-14 in trophoblast differentiation.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19414860 2009 Genetic variation in caspase genes and risk of non-Hodgkin lymphoma: a pooled analysis of 3 population-based case-control studies.
19269008 2009 Mutational analysis of CASP1, 2, 3, 4, 5, 6, 7, 8, 9, 10, and 14 genes in gastrointestinal stromal tumors.
18762957 2009 Gene expression profiling reveals alteration of caspase 6 and 14 transcripts in normal skin of keloid-prone patients.
18424262 2008 Transcription of the caspase-14 gene in human epidermal keratinocytes requires AP-1 and NFkappaB.
18309324 2008 No death without life: vital functions of apoptotic effectors.
17558860 2007 Mutational analysis of caspase-14 gene in common carcinomas.
17436577 Expression of caspase-14 reduces tumorigenicity of skin cancer cells.
17359582 2007 Caspase-14: a new player in cytotrophoblast differentiation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16854378 2006 Expression and characterization of constitutively active human caspase-14.
16341674 2005 Transcriptome analysis of human gastric cancer.
16168224 2005 Caspase-14 expression in the human placenta.
16061862 2005 Tumor-associated alterations in caspase-14 expression in epithelial malignancies.
16061209 2005 Aberrant expression of caspase-14 in epithelial tumors.
15619438 2005 Psoriasis is characterized by altered epidermal expression of caspase 14, a novel regulator of keratinocyte terminal differentiation and barrier formation.
15556625 2004 Stratum corneum-derived caspase-14 is catalytically active.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15331408 2004 Vitamin D3 induces caspase-14 expression in psoriatic lesions and enhances caspase-14 processing in organotypic skin cultures.
15301553 2004 Activation and substrate specificity of caspase-14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12445205 2002 Caspase-14 expression by epidermal keratinocytes is regulated by retinoids in a differentiation-associated manner.
12200134 2002 Processing of native caspase-14 occurs at an atypical cleavage site in normal epidermal differentiation.
12181750 2002 Expression and transcriptional regulation of caspase-14 in simple and complex epithelia.
11175259 2000 Epidermal differentiation does not involve the pro-apoptotic executioner caspases, but is associated with caspase-14 induction and processing.
11121154 2000 Terminal differentiation of human keratinocytes and stratum corneum formation is associated with caspase-14 activation.
11062009 2000 Caspase-14: analysis of gene structure and mRNA expression during keratinocyte differentiation.
10203698 1998 Identification of a new caspase homologue: caspase-14.
9823333 1998 Identification and characterization of murine caspase-14, a new member of the caspase family.
9792675 1998 Caspase-14 is a novel developmentally regulated protease.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.