Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.62
PubTator Score 24.79

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
gastric cancer 1.400 7.6e-04
hepatocellular carcinoma 1.200 6.2e-06
osteosarcoma -1.555 4.5e-06
ependymoma -1.100 5.9e-04
glioblastoma -1.800 2.7e-05
atypical teratoid / rhabdoid tumor -1.800 1.1e-04
medulloblastoma, large-cell -2.200 7.0e-06
pediatric high grade glioma -1.400 1.2e-04
group 4 medulloblastoma 1.200 3.2e-03

Gene RIF (1)

PMID Text
11832226 Cloned as a calcium- and neural-selective transcriptional activator of the gene for Brain-Derived Neurotrophic Factor (BDNF).

AA Sequence

MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLISQNIPGPLTQT      1 - 70
QTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPPTQTGMAQVIIPQGQLVDVNS     71 - 140
PRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLPKKSVTGMLEEPLLGPLQPLSSNTPIWACRL    141 - 210
RSCEKIGDSYRGYCVSETELESVLTFHKQQTQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSR    211 - 280
AVVMECQYGPRRKGFQLKKVSEQESRSCQLYKATCPARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKA    281 - 350
FNMLKKNLVDAGGVLRWYVQLPTQQAHQYHELETPCLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ    351 - 420
VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQKSLRNGDTVY    421 - 490
NSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTKVETNQTRGSLSPEPTHLLSSLSSFQPKIFT    491 - 560
QLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGSAVMNNNSLLLGQSHSLQRDTCLTQNNSTAS    561 - 630
TMGNLPEPDQNLVAMDELVEVGDVEDTGNLEGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQV    631 - 700
KQEPKEPALSMEAKKTVDYKKLSAT                                                 701 - 725
//

Text Mined References (13)

PMID Year Title
22174809 2011 Regulation of brain-derived neurotrophic factor exon IV transcription through calcium responsive elements in cortical neurons.
18555516 CARF: an emerging regulator of p53 tumor suppressor and senescence pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12154087 2002 CARF is a novel protein that cooperates with mouse p19ARF (human p14ARF) in activating p53.
11832226 2002 A calcium-responsive transcription factor, CaRF, that regulates neuronal activity-dependent expression of BDNF.
11586298 2001 A gene encoding a putative GTPase regulator is mutated in familial amyotrophic lateral sclerosis 2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.