Property Summary

NCBI Gene PubMed Count 58
PubMed Score 89.33
PubTator Score 66.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma 1.700 5.5e-06
psoriasis -2.400 7.6e-05
astrocytoma 1.200 3.8e-20
glioblastoma 1.500 1.8e-04
osteosarcoma -2.584 4.6e-08
ependymoma 1.400 3.7e-08
group 3 medulloblastoma 1.400 8.3e-04
atypical teratoid / rhabdoid tumor 1.200 2.0e-04
primitive neuroectodermal tumor 1.300 2.9e-03
adrenocortical carcinoma 1.064 3.9e-03
non-small cell lung cancer -1.395 2.2e-16
lung cancer -1.300 1.7e-02
sarcoidosis 1.400 5.6e-03
interstitial cystitis 1.500 2.3e-03
pediatric high grade glioma 1.400 7.0e-05
pilocytic astrocytoma 1.600 2.4e-06
primary Sjogren syndrome 1.300 1.2e-02
subependymal giant cell astrocytoma 1.191 2.6e-02
ulcerative colitis 1.500 4.0e-05
ovarian cancer 1.600 6.0e-04

Gene RIF (58)

PMID Text
26462578 In patients with ileal, stenotic or fistulizing Crohn's disease, the mutant-type CARD8 rs2043211 polymorphism may generate a potentially protective effect. (Meta-analysis)
26462562 There is evidence for association of gout with functional variants in CARD8, IL1B and CD14.
26283210 A novel association between CARD8 and increased risk of surgical recurrence in Crohn's disease was observed and CARD8 could be a new marker for risk stratification and prevention of recurrent surgery.
26095808 Data indicate 3 variants in 3 novel genes myc target 1 protein (MYCT1), caspase recruitment domain family member 8 (CARD8) and zinc finger protein 543 (ZNF543), associated with familial IgA nephropathy (IgAN).
25921775 CARD8 might not play a role in the pathogenesis of Tourette syndrome in Chinese Han population
25895569 The polymorphism of rs2043211 in CARD8 may be a relevant host susceptibility factor for the development of preeclampsia in the Chinese Han population.
25790751 Patients carrying genotype TT of CARD8 rs2043211 polymorphism had higher triglycerides levels compared to those carrying the AA genotype.
25564880 genetic polymorphism is associated with susceptibility to Crohn's disease under the dominant model and homozygote contrast in the European population; meta-analysis
24517500 we show that CARD8 plays a role as a negative regulator of NLRP3 inflammasome through its binding with NLRP3
24385277 ANRIL may increase the risk of ischemic stroke through regulation of the CARD8 pathway
24098386 levels of inflammasome-produced cytokines as a measure of inflammasome activation in healthy individuals carrying Q705K polymorphism in the NLRP3 gene combined with C10X in the CARD8 gene
23695559 The first crystal structure of the CARD8 caspase-recruitment domain is reported. It adopts a six-helix bundle fold with a unique conformation of the alpha6 helix that is described for the first time.
23611467 Data indicate that CARD8 (caspase recruitment domain 8) mRNA was highly expressed in atherosclerotic plaques, and the minor allele was associated with lower expression of CARD8 in the plaques, suggesting that CARD8 may promote inflammation.
23563199 Genetic variation in the inflammasome affects atopic dermatitis susceptibility.
23547871 In a Swedish population, the minor allele of CARD8-C10X is associated with a decreased risk of AS, but not with levels of faecal calprotectin or disease phenotype.
23507658 The results of this study support the novel association between CARD8 gene and HIV+tuberculosis coinfection, demonstrating that inflammasome genetics could influence HIV-1 infection and the development of opportunistic infection.
23506543 Mutation in the CARD8, a component of inflammasome, is associated with lower levels of antibodies directed to mannans and glucans at least in Crohn's disease patients.
23088220 Results suggest that the CARD8 rs2043211 gene variant does not in susceptibility to rheumatoid arthritis (RA) or in the development of cardiovascular disease in patients with RA.
23053059 we performed a genetic association study in patients with pneumococcal meningitis and found that single-nucleotide polymorphisms in the inflammasome genes CARD8 and NLRP1 are associated with poor disease outcome.
22227487 Twelve single nucleotide polymorphisms within NLRP1, NLRP3, NLRC4, CARD8, CASP1, and IL1B genes were analyzed in 150 HIV-1-infected Brazilian subjects.
22128899 Variations in the CARD8 and NLRP3 genes are not associated with rheumatoid arthritis in the French as well general Tunisian population.
22087307 results identify a function for the FIIND and show that CARD8 and NLRP1 are ZU5-UPA domain-containing autoproteolytic proteins, thus suggesting a novel mechanism for regulating innate immune responses
21621776 analysis of interaction of the inflammasome genes CARD8 and NLRP3 in abdominal aortic aneurysms
21308686 Caspase8 polymorphism IVS12-19 G>A but not CASP8 -652 6N del polymorphism may modulate risk of esophageal squamous cell carcinoma and its survival outcome in northern Indian population.
21248762 CARD8 variants might have roles in the pathogenesis of Crohn's disease and ulcerative colitis in Koreans
20800603 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20385562 Data show that CARD8 represents a novel molecular switch involved in the endogenous regulation of NOD2-dependent inflammatory processes in epithelial cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20182451 propose that CARD8-NALP3 genotype combinations protect against gut inflammation by preventing the NALP3 inflammasome from producing excessive interleukin-1be
20182451 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19940360 Study shows an essential role for apoptosis signal-regulating kinase 1 (ASK1), together with both c-jun-N-terminal kinase (JNK) and p38 pathways, and caspase-8 in Fas-induced apoptosis.
19843337 Variation in the innate immunity genes CARD4, CARD8 and CARD15 is unlikely to play a major role in the susceptibility to CRC in the German population.
19843337 Observational study of gene-disease association. (HuGE Navigator)
19664744 Observational study of gene-disease association. (HuGE Navigator)
19443463 Carriage of CARD8-X is associated with a worse disease course in early rheumatoid arthritis.
19319132 CARD8 and NALP3 genes combined polymorphism has a role of developing Crohn disease in men.
19319132 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19252766 Gene-gene interaction between CARD8 and interleukin-6 reduces Alzheimer's disease risk.
19252766 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19074885 Observational study of gene-disease association. (HuGE Navigator)
18841008 Women, but not men, carrying the CARD8 AA genotype (truncated protein) had a 2.39-fold higher risk of developing Alzheimer's disease than subjects with the CARD8 TT genotype (full-length protein)
18841008 Observational study of gene-disease association. (HuGE Navigator)
18311798 The NALP3 and TUCAN single-nucleotide polymorphisms may explain the increased IL-1beta levels and inflammatory symptoms observed, but further studies are needed to reveal a functional relationship.
18311798 Observational study of genotype prevalence. (HuGE Navigator)
18263599 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18212821 isoforms of CARD8 differ in their N-termini, resulting in diverse predicted molecular weights (47, 48, 51, 54 and 60 kDa) and multiple outcomes for the variant including Cys10Stop, Cys34Stop, Phe52Ile and Phe102Ile
18092344 Analyzing 3 independent European IBD cohorts, we found no evidence that the C10X variant in CARD8 confers susceptibility for CD.
18092344 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17878386 deleterious polymorphism of CARD8 may help predict the severity of rheumatoid arthritis
17595233 Observational study of gene-disease association. (HuGE Navigator)
17484912 no significant association between the risk allele "A" at Cys10Stop and risk for Crohn's disease or ulcerative colitis was detected in patients of German and Norwegian descent
17030188 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17030188 association between a likely functional polymorphism in TUCAN and Crohn disease
16796750 TUCAN does not play a role in inhibition of procaspase-9 and in determining the sensitivity to cisplatin in Non Small Cells Lung Cancer.
12067710 TUCAN/CARDINAL and DRAL participate in a common pathway for modulation of NF-kappaB activation.
11956601 Expression and characterization of NDPP1
11821383 CARD-8 protein, a new CARD family member that regulates caspase-1 activation and apoptosis. (card-8 protein)

AA Sequence

MMRQRQSHYCSVLFLSVNYLGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDK      1 - 70
STNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAV     71 - 140
AEIHLPHFISLQGEVDVSWFLVAHFKNEGMVLEHPARVEPFYAVLESPSFSLMGILLRIASGTRLSIPIT    141 - 210
SNTLIYYHPHPEDIKFHLYLVPSDALLTKAIDDEEDRFHGVRLQTSPPMEPLNFGSSYIVSNSANLKVMP    211 - 280
KELKLSYRSPGEIQHFSKFYAGQMKEPIQLEITEKRHGTLVWDTEVKPVDLQLVAASAPPPFSGAAFVKE    281 - 350
NHRQLQARMGDLKGVLDDLQDNEVLTENEKELVEQEKTRQSKNEALLSMVEKKGDLALDVLFRSISERDP    351 - 420
YLVSYLRQQNL                                                               421 - 431
//

Text Mined References (59)

PMID Year Title
26462578 2015 Is the CARD8 rs2043211 polymorphism associated with susceptibility to Crohn's disease? A meta-analysis.
26462562 2015 Multiplicative interaction of functional inflammasome genetic variants in determining the risk of gout.
26283210 2015 CARD8 gene variant is a risk factor for recurrent surgery in patients with Crohn's disease.
26095808 2015 Novel genes and variants associated with IgA nephropathy by co-segregating with the disease phenotypes in 10 IgAN families.
25921775 2015 rs2043211 polymorphism in CARD8 is not associated with Tourette syndrome in a family-based association study in the Chinese Han population.
25895569 2015 The Association of CARD8 rs2043211 Polymorphism with Preeclampsia in the Chinese Han Population.
25790751 2015 CARD8 rs2043211 polymorphism is associated with gout in a Chinese male population.
25564880 2015 Association between CARD8 rs2043211 polymorphism and inflammatory bowel disease: a meta-analysis.
24517500 2014 CARD8 is a negative regulator for NLRP3 inflammasome, but mutant NLRP3 in cryopyrin-associated periodic syndromes escapes the restriction.
24385277 2014 Regulation of CARD8 expression by ANRIL and association of CARD8 single nucleotide polymorphism rs2043211 (p.C10X) with ischemic stroke.
24098386 2013 Cytokine profile in a cohort of healthy blood donors carrying polymorphisms in genes encoding the NLRP3 inflammasome.
23695559 2013 The structure of the CARD8 caspase-recruitment domain suggests its association with the FIIND domain and procaspases through adjacent surfaces.
23611467 2013 CARD8 gene encoding a protein of innate immunity is expressed in human atherosclerosis and associated with markers of inflammation.
23563199 2013 Genetic variation in the inflammasome and atopic dermatitis susceptibility.
23547871 2013 Genetic variants in CARD8 but not in NLRP3 are associated with ankylosing spondylitis.
23507658 2013 Susceptibility to Mycobacterium tuberculosis infection in HIV-positive patients is associated with CARD8 genetic variant.
23506543 2013 The CARD8 p.C10X mutation associates with a low anti-glycans antibody response in patients with Crohn's disease.
23088220 2013 CARD8 rs2043211 (p.C10X) polymorphism is not associated with disease susceptibility or cardiovascular events in Spanish rheumatoid arthritis patients.
23053059 2013 Genetic variation in inflammasome genes is associated with outcome in bacterial meningitis.
22227487 2012 Polymorphisms in inflammasome' genes and susceptibility to HIV-1 infection.
22128899 2012 Association study of CARD8 (p.C10X) and NLRP3 (p.Q705K) variants with rheumatoid arthritis in French and Tunisian populations.
22087307 2011 CARD8 and NLRP1 undergo autoproteolytic processing through a ZU5-like domain.
21621776 2011 Interaction of the inflammasome genes CARD8 and NLRP3 in abdominal aortic aneurysms.
21308686 2011 CASP8 -652 6N del and CASP8 IVS12-19G>A gene polymorphisms and susceptibility/prognosis of ESCC: a case control study in northern Indian population.
21248762 2011 Association of CARD8 with inflammatory bowel disease in Koreans.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20385562 2010 Caspase recruitment domain-containing protein 8 (CARD8) negatively regulates NOD2-mediated signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20182451 2010 Evidence of interaction of CARD8 rs2043211 with NALP3 rs35829419 in Crohn's disease.
19940360 2009 Fas-induced apoptosis of renal cell carcinoma is mediated by apoptosis signal-regulating kinase 1 via mitochondrial damage-dependent caspase-8 activation.
19843337 2009 Investigation of innate immunity genes CARD4, CARD8 and CARD15 as germline susceptibility factors for colorectal cancer.
19664744 2009 A genome-wide in vitro bacterial-infection screen reveals human variation in the host response associated with inflammatory disease.
19443463 2010 CARD8 p.C10X polymorphism is associated with inflammatory activity in early rheumatoid arthritis.
19319132 2009 Combined polymorphisms in genes encoding the inflammasome components NALP3 and CARD8 confer susceptibility to Crohn's disease in Swedish men.
19252766 2009 Gene-gene interaction between CARD8 and interleukin-6 reduces Alzheimer's disease risk.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
18841008 2008 Deficiency of CARD8 is associated with increased Alzheimer's disease risk in women.
18311798 2008 Gene polymorphisms in the NALP3 inflammasome are associated with interleukin-1 production and severe inflammation: relation to common inflammatory diseases?
18263599 2008 Genetic variation in proteins of the cryopyrin inflammasome influences susceptibility and severity of rheumatoid arthritis (the Swedish TIRA project).
18212821 2008 Novel isoforms of the CARD8 (TUCAN) gene evade a nonsense mutation.
18092344 2008 No association of the CARD8 (TUCAN) c.30T>A (p.C10X) variant with Crohn's disease: a study in 3 independent European cohorts.
17878386 2007 Deficiency of the NF-kappaB inhibitor caspase activating and recruitment domain 8 in patients with rheumatoid arthritis is associated with disease severity.
17595233 2007 Mutations in pattern recognition receptor genes modulate seroreactivity to microbial antigens in patients with inflammatory bowel disease.
17484912 2007 No association between the TUCAN (CARD8) Cys10Stop mutation and inflammatory bowel disease in a large retrospective German and a clinically well-characterized Norwegian sample.
17030188 2006 TUCAN (CARD8) genetic variants and inflammatory bowel disease.
16796750 2006 TUCAN/CARDINAL/CARD8 and apoptosis resistance in non-small cell lung cancer cells.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15030775 2004 NALP3 forms an IL-1beta-processing inflammasome with increased activity in Muckle-Wells autoinflammatory disorder.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12067710 2002 TUCAN/CARDINAL and DRAL participate in a common pathway for modulation of NF-kappaB activation.
11956601 2002 NDPP1 is a novel CARD domain containing protein which can inhibit apoptosis and suppress NF-kappaB activation.
11821383 2002 CARD-8 protein, a new CARD family member that regulates caspase-1 activation and apoptosis.
11551959 2001 CARDINAL, a novel caspase recruitment domain protein, is an inhibitor of multiple NF-kappa B activation pathways.
11408476 2001 TUCAN, an antiapoptotic caspase-associated recruitment domain family protein overexpressed in cancer.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.