Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.51
PubTator Score 2.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
astrocytic glioma -1.100 3.6e-02
group 4 medulloblastoma -1.300 5.4e-04
medulloblastoma, large-cell -1.600 3.4e-05
ovarian cancer 1.100 9.5e-05

 GO Function (1)

Gene RIF (2)

AA Sequence

MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQ      1 - 70
RSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPG     71 - 140
LASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRG    141 - 210
SLHVCVDSNLVPTAAWRS                                                        211 - 228
//

Text Mined References (8)

PMID Year Title