Property Summary

NCBI Gene PubMed Count 36
PubMed Score 20.84
PubTator Score 13.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGY      1 - 70
EDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSWRESCDSALRAYVKDHYSNGF     71 - 140
CTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVVGVLKIQVHYYEDGNVQLVSHK    141 - 210
DVQDSLTVSNEAQTAKEFIKIIENAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIG    211 - 280
KEMQNA                                                                    281 - 286
//

Text Mined References (43)

PMID Year Title