Property Summary

NCBI Gene PubMed Count 14
PubMed Score 31.97
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 1.2
Disease Target Count Z-score Confidence
Severe acute respiratory syndrome 27 3.679 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
group 3 medulloblastoma 1.500 4.9e-03
malignant mesothelioma 1.100 2.3e-06
Multiple myeloma 1.333 1.7e-04
osteosarcoma 1.909 2.1e-04
ovarian cancer -1.200 2.8e-03
posterior fossa group B ependymoma 1.100 6.2e-06

Gene RIF (5)

AA Sequence

MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSA      1 - 70
VQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLA     71 - 140
RQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIE    141 - 210
VLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSF    211 - 280
SIKQTIVSDCSFVASLAISAAYERRFNKKLITGIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQ    281 - 350
LPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKD    351 - 420
NSFRMLYQRFHKGDVLITASTGMMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYS    421 - 490
ENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNPGLFKESTCIHSTWDAKQGPV    491 - 560
KDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYYPADPPPYIDG    561 - 630
IRINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTFSKIPSPYTLSKRINGKWSGQS    631 - 700
AGGCGNFQETHKNNPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFC    701 - 770
YLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ                               771 - 813
//

Text Mined References (16)

PMID Year Title