Property Summary

NCBI Gene PubMed Count 14
PubMed Score 29.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.333 1.7e-04
malignant mesothelioma 1.100 2.3e-06
osteosarcoma 1.909 2.1e-04
group 3 medulloblastoma 1.500 4.9e-03
posterior fossa group B ependymoma 1.100 6.2e-06
ovarian cancer -1.200 2.8e-03

Gene RIF (5)

PMID Text
24953135 The proteolytic activity of CAPN7 is important for the acceleration of EGFR degradation via the endosomal sorting pathway.
23855590 Data indicate that CAPN 7 promotes endometrial stromal cell (hESC) migration and invasion by increasing the activity of MMP-2 via an increased ratio of MMP-2 to TIMP-2.
23497113 Mutational analysis of calpain-7 reveals the importance of not only the N-terminal microtubule-interacting and trafficking domains but also the C-terminal C2 domain-like domains for proteolytic activity.
21616915 The detected enhancement of autolysis of mGFP-fused calpain-7 by coexpression with CHMP1B and observed further activation by additional coexpression of IST1 in HEK293T cells.
20849418 Results demonstrate that human calpain 7 is proteolytically active, and imply that calpain 7 is activated by ESCRT-III-related protein IST1.

AA Sequence

MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSA      1 - 70
VQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLA     71 - 140
RQALDRAEALSEPLTKPVGKISSTSVKPKPPPVRAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIE    141 - 210
VLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSF    211 - 280
SIKQTIVSDCSFVASLAISAAYERRFNKKLITGIIYPQNKDGEPEYNPCGKYMVKLHLNGVPRKVIIDDQ    281 - 350
LPVDHKGELLCSYSNNKSELWVSLIEKAYMKVMGGYDFPGSNSNIDLHALTGWIPERIAMHSDSQTFSKD    351 - 420
NSFRMLYQRFHKGDVLITASTGMMTEAEGEKWGLVPTHAYAVLDIREFKGLRFIQLKNPWSHLRWKGRYS    421 - 490
ENDVKNWTPELQKYLNFDPRTAQKIDNGIFWISWDDLCQYYDVIYLSWNPGLFKESTCIHSTWDAKQGPV    491 - 560
KDAYSLANNPQYKLEVQCPQGGAAVWVLLSRHITDKDDFANNREFITMVVYKTDGKKVYYPADPPPYIDG    561 - 630
IRINSPHYLTKIKLTTPGTHTFTLVVSQYEKQNTIHYTVRVYSACSFTFSKIPSPYTLSKRINGKWSGQS    631 - 700
AGGCGNFQETHKNNPIYQFHIEKTGPLLIELRGPRQYSVGFEVVTVSTLGDPGPHGFLRKSSGDYRCGFC    701 - 770
YLELENIPSGIFNIIPSTFLPKQEGPFFLDFNSIIPIKITQLQ                               771 - 813
//

Text Mined References (16)

PMID Year Title
24953135 2014 Involvement of calpain-7 in epidermal growth factor receptor degradation via the endosomal sorting pathway.
23855590 2013 CAPN 7 promotes the migration and invasion of human endometrial stromal cell by regulating matrix metalloproteinase 2 activity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23497113 2013 Analysis of limited proteolytic activity of calpain-7 using non-physiological substrates in mammalian cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21616915 2011 Calpain-7 binds to CHMP1B at its second ?-helical region and forms a ternary complex with IST1.
20849418 2010 Autolytic activity of human calpain 7 is enhanced by ESCRT-III-related protein IST1 through MIT-MIM interaction.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11342116 2001 Molecular cloning of PalBH, a mammalian homologue of the Aspergillus atypical calpain PalB.
10051333 1999 Capn7: a highly divergent vertebrate calpain with a novel C-terminal domain.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8163008 1994 New era of calpain research. Discovery of tissue-specific calpains.