Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.31
PubTator Score 8.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.300 1.1e-05
psoriasis -1.100 1.7e-03
osteosarcoma 3.136 3.8e-02
medulloblastoma, large-cell 1.300 1.1e-02
Duchenne muscular dystrophy 2.112 4.7e-11
juvenile dermatomyositis 1.289 3.7e-08
chronic kidney disease 1.600 9.9e-03
breast carcinoma -1.800 9.8e-04
invasive ductal carcinoma -3.304 4.8e-05
Endometriosis -2.594 1.0e-02
non-inflammatory breast cancer -3.500 2.2e-08

Synonym

Accession Q9Y6Q1 D3DUY7 Q9UEQ1 Q9UJA8
Symbols CANPX
CAPNX
CalpM
DJ914P14.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
21681744 syndecan-2 exerts its pro-apoptotic function through modulation of the endothelin-1/NFkappaB signaling and through downregulation of calpain-6.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20414141 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18657900 results indicated that calpain 6 supported tumorigenesis by inhibiting apoptosis and facilitating angiogenesis. To our knowledge, this result is the first evidence implicating calpain 6 in tumorigenesis
18187620 Knockdown of calpain 6 (CAPN6) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGPPLKLFKNQKYQELKQECIKDSRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDDPHLIVGNISN      1 - 70
HQLTQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQKTEKYAGIFHFRFWHFGEWTEVVIDDLL     71 - 140
PTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGLTITDIIVDFTGTLAETVDMQKGRYTELVEE    141 - 210
KYKLFGELYKTFTKGGLICCSIESPNQEEQEVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSAEKVYMV    211 - 280
RLRNPLGRQEWSGPWSEISEEWQQLTASDRKNLGLVMSDDGEFWMSLEDFCRNFHKLNVCRNVNNPIFGR    281 - 350
KELESVLGCWTVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI    351 - 420
IGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTSEFLLRIFSEV    421 - 490
PVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPYLVIKCGKEEVRSPVQKNTVH    491 - 560
AIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDADPSDCRDLKSLYLRKKGGPTAKVKQGHISF    561 - 630
KVISSDDLTEL                                                               631 - 641
//

Text Mined References (16)

PMID Year Title
21681744 2012 Calpain-6 is an endothelin-1 signaling dependent protective factor in chemoresistant osteosarcoma.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20414141 2010 Family-based association study for bipolar affective disorder.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18657900 2008 Calpain 6 supports tumorigenesis by inhibiting apoptosis and facilitating angiogenesis.
17210638 2007 Calpain 6 is involved in microtubule stabilization and cytoskeletal organization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10340998 1999 Calpain-calpastatin: a novel, complete calcium-dependent protease system in human spermatozoa.
9503024 1998 Genomic organization of mouse Capn5 and Capn6 genes confirms that they are a distinct calpain subfamily.
9339374 1997 A new subfamily of vertebrate calpains lacking a calmodulin-like domain: implications for calpain regulation and evolution.
8401585 1993 Rapid cDNA sequencing (expressed sequence tags) from a directionally cloned human infant brain cDNA library.
8163008 1994 New era of calpain research. Discovery of tissue-specific calpains.