Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.41
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (5)

AA Sequence

MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG      1 - 70
MGEKPPSGV                                                                  71 - 79
//

Text Mined References (10)

PMID Year Title