Property Summary

Ligand Count 4
NCBI Gene PubMed Count 126
PubMed Score 7.03
PubTator Score 788.48

Knowledge Summary

Patent (10,273)

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy -1.321 3.9e-05
adult high grade glioma -1.800 5.5e-05
Astrocytoma, Pilocytic -1.400 1.5e-06
atypical teratoid / rhabdoid tumor -1.600 9.9e-06
dermatomyositis -1.200 6.2e-04
ependymoma -1.400 5.9e-07
glioblastoma -1.800 6.1e-08
group 3 medulloblastoma -1.800 5.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.2e-02
malignant mesothelioma 1.100 1.1e-05
medulloblastoma, large-cell -1.400 6.6e-03
osteosarcoma -1.297 1.9e-02
pituitary cancer 1.300 9.1e-06
primitive neuroectodermal tumor -1.400 1.1e-03
subependymal giant cell astrocytoma -2.105 1.1e-02
tuberculosis 1.100 1.0e-04

Gene RIF (56)

AA Sequence

MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLEREARICRLLKH      1 - 70
PNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQILESVNHIHQHDIVHRDLKPE     71 - 140
NLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGYLSPEVLRKDPYGKPVDIWACGVILYILLVG    141 - 210
YPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVAS    211 - 280
MMHRQETVECLRKFNARRKLKGAILTTMLVSRNFSAAKSLLNKKSDGGVKKRKSSSSVHLMPQSNNKNSL    281 - 350
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKARSPEGRSSRDRTAPSAGMQPQPSL    351 - 420
CSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPI    421 - 490
HTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ      491 - 558
//

Text Mined References (136)

PMID Year Title