Property Summary

NCBI Gene PubMed Count 49
PubMed Score 61.38
PubTator Score 40.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -1.100 1.9e-05
astrocytic glioma -1.300 5.5e-03
ependymoma 1.600 6.1e-09
oligodendroglioma -1.400 6.3e-03
psoriasis -2.000 9.9e-05
glioblastoma 1.800 2.1e-03
osteosarcoma 3.659 3.7e-07
cystic fibrosis -1.642 4.9e-05
atypical teratoid/rhabdoid tumor 1.800 3.0e-05
medulloblastoma, large-cell 1.200 1.9e-03
adrenocortical carcinoma 1.582 2.4e-03
tuberculosis and treatment for 6 months 1.300 1.2e-04
non-small cell lung cancer 1.662 9.4e-13
intraductal papillary-mucinous carcinoma... 1.100 2.6e-02
lung cancer 1.200 4.0e-04
active Crohn's disease 1.274 6.7e-03
diabetes mellitus -1.600 5.9e-03
Breast cancer 2.500 3.2e-02
interstitial cystitis 1.200 1.3e-04
pediatric high grade glioma 1.900 1.5e-04
pilocytic astrocytoma 1.300 3.7e-04
sonic hedgehog group medulloblastoma 1.100 1.9e-02
lung adenocarcinoma 1.268 3.5e-05
ulcerative colitis 1.800 7.9e-07
ovarian cancer 2.400 5.1e-06
pituitary cancer -1.300 6.2e-04

 GO Function (1)

Protein-protein Interaction (1)

Gene RIF (25)

PMID Text
26124285 Results provide direct evidence for the involvement of CALU and LGALS3BP as potential negative regulators in the virus-triggered induction of the typeI interferons.
25963840 Results show that OSBPL5 and CALU were expressed at higher levels in the lung tissues of metastasis-positive cases than that in the metastasis-negative cases suggesting they can promote invasiveness of lung cancer cells.
25823396 CALU polymorphism A29809G affects calumenin availability involving vascular calcification
25120007 Calumenin is characterized as a charged protein exhibiting close similarity with intrinsically disordered proteins and is hypothesized to regulate F508del-CFTR folding by electrostatic effects.
22768251 Calumenin is a new CFTR chaperone.
22514732 Study found the secretion of calu-1/2-EGFP required microtubule integrity, and that calu-1/2-EGFP-containing vesicles were transported by the motor proteins Kif5b and cytoplasmic dynein.
22190034 HIV-1 gp120 is identified to have a physical interaction with calumenin (CALU) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22188360 Quantitative PCR assays for VKORC1, CYP4F2, GGCX and CALU identified two copies in all populations.
21057703 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20673165 associated with arterial calcification and short-term prognosis of the outcome of patients with non-ST-elevation acute coronary syndrome
20673165 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20553802 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20499136 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20200517 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20149073 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20020283 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19958090 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19794411 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18688696 Data show that calumenin in the presence of calcium binds specifically to thrombospondin-1, but closely-related reticulocalbin does not form a similar complex.
17596133 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17189218 Observational study of gene-disease association. (HuGE Navigator)
17049586 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17048007 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKTFDQLTPEESK      1 - 70
ERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDD     71 - 140
PDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDL    141 - 210
EEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQN    211 - 280
KDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF                                       281 - 315
//

Text Mined References (59)

PMID Year Title
26124285 2015 Quantitative Proteomics Reveals the Roles of Peroxisome-associated Proteins in Antiviral Innate Immune Responses.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25963840 2015 Identification and evaluation of metastasis-related proteins, oxysterol binding protein-like 5 and calumenin, in lung tumors.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25823396 2015 CALU polymorphism A29809G affects calumenin availability involving vascular calcification.
25416956 2014 A proteome-scale map of the human interactome network.
25120007 2014 Biophysical characterisation of calumenin as a charged F508del-CFTR folding modulator.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23704328 2013 Genome-wide association study of primary tooth eruption identifies pleiotropic loci associated with height and craniofacial distances.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22768251 2012 Proteomic identification of calumenin as a G551D-CFTR associated protein.
22514732 2012 The intracellular transport and secretion of calumenin-1/2 in living cells.
22188360 2012 Copy number variation and warfarin dosing: evaluation of CYP2C9, VKORC1, CYP4F2, GGCX and CALU.
21269460 2011 Initial characterization of the human central proteome.
21057703 2011 Impact of pharmacokinetic (CYP2C9) and pharmacodynamic (VKORC1, F7, GGCX, CALU, EPHX1) gene variants on the initiation and maintenance phases of phenprocoumon therapy.
20673165 2010 CALU A29809G polymorphism in coronary atherothrombosis: Implications for coronary calcification and prognosis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20553802 2010 Application of Akaike information criterion to evaluate warfarin dosing algorithm.
20499136 2010 An evaluation of nine genetic variants related to metabolism and mechanism of action of warfarin as applied to stable dose prediction.
20200517 2010 A polymorphism in the VKORC1 regulator calumenin predicts higher warfarin dose requirements in African Americans.
20149073 2010 Pharmacogenetics of acenocoumarol in patients with extreme dose requirements.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20020283 2010 Genetic determinants of acenocoumarol and phenprocoumon maintenance dose requirements.
19958090 2009 Genetic determinants of warfarin dosing in the Han-Chinese population.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19794411 2010 Genetic factors (VKORC1, CYP2C9, EPHX1, and CYP4F2) are predictor variables for warfarin response in very elderly, frail inpatients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18688696 2009 Calumenin but not reticulocalbin forms a Ca2+-dependent complex with thrombospondin-1. A potential role in haemostasis and thrombosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17596133 2007 The genetic interaction between VKORC1 c1173t and calumenin a29809g modulates the anticoagulant response of acenocoumarol.
17189218 2006 Polymorphisms in vitamin K-dependent gamma-carboxylation-related genes influence interindividual variability in plasma protein C and protein S activities in the general population.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
17049586 2007 Genotypes of vitamin K epoxide reductase, gamma-glutamyl carboxylase, and cytochrome P450 2C9 as determinants of daily warfarin dose in Japanese patients.
17048007 2007 Association of warfarin dose with genes involved in its action and metabolism.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11827452 2002 Gene expression profile of human bone marrow stromal cells: high-throughput expressed sequence tag sequencing analysis.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10631319 2000 Calumenin interacts with serum amyloid P component.
10222138 1999 Human calumenin localizes to the secretory pathway and is secreted to the medium.
10094503 1999 Crocalbin: a new calcium-binding protein that is also a binding protein for crotoxin, a neurotoxic phospholipase A2.
9675259 1998 Molecular cloning of a cDNA encoding human calumenin, expression in Escherichia coli and analysis of its Ca2+-binding activity.
9598325 1998 Human calumenin gene (CALU): cDNA isolation and chromosomal mapping to 7q32.
9218460 1997 Calumenin, a Ca2+-binding protein retained in the endoplasmic reticulum with a novel carboxyl-terminal sequence, HDEF.