Property Summary

NCBI Gene PubMed Count 17
PubMed Score 12.71
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma -4.200 1.3e-04
posterior fossa group A ependymoma -5.400 3.3e-14
group 4 medulloblastoma -4.500 3.4e-07
atypical teratoid / rhabdoid tumor -3.600 1.1e-04
medulloblastoma, large-cell -5.600 1.1e-06
primitive neuroectodermal tumor -3.400 6.8e-03
interstitial cystitis -1.500 5.1e-03
pediatric high grade glioma -3.300 1.4e-04
subependymal giant cell astrocytoma -2.829 2.0e-02
lung carcinoma 2.500 3.1e-09
Pick disease -1.200 3.1e-04
pituitary cancer 2.200 2.3e-04
psoriasis -1.200 6.9e-26

Gene RIF (8)

PMID Text
25869804 A significant association was observed for the single-nucleotide polymorphism (SNP) rs17518584 and in the joint discovery and replication meta-analysis in an intron of the gene cell adhesion molecule 2 (CADM2) for performance on the LDST/DSST.
25335893 In the absence of SynCAMs, selective axon-axon interactions are perturbed resulting in aberrant pathfinding of sensory axons.
24240726 Cox regression analysis indicated that CADM2 expression level, tumor size, tumor number, vascular invasion, HBsAg were independent risk factors for HCC recurrence
23643812 Thus, we conclude that CADM2 functions as a novel tumor suppressor and may serve as a potential therapeutic target for human renal cell carcinoma.
21864505 The results indicated that CADM2 is one of the pathogenic factors for psoriasis.
21062931 Its expression is regulated in part by promoter methylation and implicates CADM-2 as a previously unrecognized tumor suppressor gene in a proportion of human prostate cancers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19861958 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKK      1 - 70
ALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGD     71 - 140
LMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESL    141 - 210
NATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRE    211 - 280
LNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATT    281 - 350
SSIRDPNALAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA    351 - 420
EGSQVNAEEKKEYFI                                                           421 - 435
//

Text Mined References (20)

PMID Year Title
25869804 2016 GWAS for executive function and processing speed suggests involvement of the CADM2 gene.
25335893 2014 The SynCAM synaptic cell adhesion molecules are involved in sensory axon pathfinding by regulating axon-axon contacts.
25199915 2015 GWAS of longevity in CHARGE consortium confirms APOE and FOXO3 candidacy.
24240726 2014 Low CADM2 expression predicts high recurrence risk of hepatocellular carcinoma patients after hepatectomy.
23643812 2013 Aberrant methylation and loss of CADM2 tumor suppressor expression is associated with human renal cell carcinoma tumor progression.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
22832960 2012 A genome-wide meta-analysis of association studies of Cloninger's Temperament Scales.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21864505 2011 A novel splicing variant of CADM2 as a protective transcript of psoriasis.
21062931 2010 Hypoexpression and epigenetic regulation of candidate tumor suppressor gene CADM-2 in human prostate cancer.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19861958 2010 Genetic analysis in a Dutch study sample identifies more ulcerative colitis susceptibility loci and shows their additive role in disease risk.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17967169 2007 The adhesion molecule Necl-3/SynCAM-2 localizes to myelinated axons, binds to oligodendrocytes and promotes cell adhesion.
16311015 2006 Bioinformatic characterization of the SynCAM family of immunoglobulin-like domain-containing adhesion molecules.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.