Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.53
PubTator Score 13.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.700 1.5e-02
atypical teratoid / rhabdoid tumor -1.500 4.5e-02
ependymoma -2.300 3.7e-10
glioblastoma -2.300 1.2e-03
group 3 medulloblastoma -2.800 1.0e-02
interstitial cystitis -1.500 5.1e-03
lung carcinoma 2.500 3.1e-09
medulloblastoma, large-cell -2.200 2.3e-05
Pick disease -1.200 3.1e-04
pituitary cancer 1.600 4.4e-05
primitive neuroectodermal tumor -1.400 2.5e-02
psoriasis -1.200 6.9e-26
subependymal giant cell astrocytoma -1.713 3.4e-02

Gene RIF (9)

AA Sequence

MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKK      1 - 70
ALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGD     71 - 140
LMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESL    141 - 210
NATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRE    211 - 280
LNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATT    281 - 350
SSIRDPNALAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA    351 - 420
EGSQVNAEEKKEYFI                                                           421 - 435
//

Text Mined References (21)

PMID Year Title