Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.36
PubTator Score 3.38

Knowledge Summary

Patent (193)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.6
Disease Target Count Z-score Confidence
Renal oncocytoma 21 3.728 1.9

Expression

AA Sequence

MSHCSSRALTLLSSVFGACGLLLVGIAVSTDYWLYMEEGTVLPQNQTTEVKMALHAGLWRVCFFAGREKG      1 - 70
RCVASEYFLEPEINLVTENTENILKTVRTATPFPMVSLFLVFTAFVISNIGHIRPQRTILAFVSGIFFIL     71 - 140
SGLSLVVGLVLYISSINDEVMNRPSSSEQYFHYRYGWSFAFAASSFLLKEGAGVMSVYLFTKRYAEEEMY    141 - 210
RPHPAFYRPRLSDCSDYSGQFLQPEAWRRGRSPSDISSDVSIQMTQNYPPAIKYPDHLHISTSPC         211 - 275
//

Text Mined References (7)

PMID Year Title