Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.00
PubTator Score 0.90

Knowledge Summary

Patent (179)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cognitive disorder 44 0.0 1.0

Gene RIF (1)

PMID Text
21057379 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVIVPQNQSTEIKMSLHSGLWRVCFLAGEERG      1 - 70
RCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILNNIGHIRPHRTILAFVSGIFFIL     71 - 140
SGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFAFAAISFLLTESAGVMSVYLFMKRYTAEDMY    141 - 210
RPHPGFYRPRLSNCSDYSGQFLHPDAWVRGRSPSDISSEASLQMNSNYPALLKCPDYDQMSSSPC         211 - 275
//

Text Mined References (9)

PMID Year Title
21057379 2011 Case-case genome-wide association analysis shows markers differentially associated with schizophrenia and bipolar disorder and implicates calcium channel genes.
17652770 2007 Calcium channel gamma subunits: a functionally diverse protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11927536 2002 The novel product of a five-exon stargazin-related gene abolishes Ca(V)2.2 calcium channel expression.
11738816 2001 Calcium channel gamma subunits provide insights into the evolution of this gene family.
11170751 2001 A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family.
10613843 1999 Identification of three novel Ca(2+) channel gamma subunit genes reveals molecular diversification by tandem and chromosome duplication.