Property Summary

NCBI Gene PubMed Count 18
PubMed Score 38.73
PubTator Score 15.17

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.400 3.1e-05
osteosarcoma 2.120 3.2e-08

Gene RIF (9)

AA Sequence

MTTEQARGQQGPNLAIGRQKPPAGVVTPKSDAEEPPLTRKRSKKERGLRGSRKRTGSSGEQTGPEAPGSS      1 - 70
NNPPSTGEGPAGAPPASPGPASSRQSHRHRPDSLHDAAQRTYGPLLNRVFGKDRELGPEELDELQAAFEE     71 - 140
FDTDRDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMRMGGRVDFEEFVELIGPKLREETAHMLGVRE    141 - 210
LRIAFREFDRDRDGRITVAELREAVPALLGEPLAGPELDEMLREVDLNGDGTVDFDEFVMMLSRH         211 - 275
//

Text Mined References (18)

PMID Year Title