Property Summary

NCBI Gene PubMed Count 34
PubMed Score 2068.00
PubTator Score 1396.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.300 8.9e-06
ependymoma 1.300 3.9e-03

Protein-protein Interaction (6)

Gene RIF (17)

PMID Text
23939952 Results indicate an important role for LMP1 and Cabin1 in regulating apoptosis in nasopharyngeal carcinoma cells in response to genotoxic stress.
23624525 Two new susceptibility loci for amyotrophic lateral sclerosis in the Han Chinese population in chromosome 1, CAMK1G and chromosome 22, SUSD2 and CABIN1.
22401310 NHRD domain of UBN1 as being an essential region for HIRA interaction and chromatin organization by the HUCA complex
22275266 Our findings demonstrate that hCABIN-1 plays a critical role in promoting apoptosis of fibroblast-like synoviocytes and in attenuating inflammation and cartilage and bone destruction in rheumatoid arthritis.
21807893 Data show that, like HIRA, UBN1, and ASF1a, CABIN1 is involved in heterochromatinization of the genome of senescent human cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20075944 CABIN1 may not confer increased susceptibility for schizophrenia in the Japanese population.
20075944 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19817957 Observational study of gene-disease association. (HuGE Navigator)
19717561 the association of CAIN with intracellular domains involved in mGluR/G protein coupling provides a mechanism by which Group I mGluR endocytosis and signaling are regulated
19668210 Cabin1 inhibits p53 function on chromatin in the quiescent state; the presence of inactive p53 on some promoters might allow a prompt response upon DNA damage.
17531200 Here, we report that Cabin1 has additional CN binding domain in its 701-900 amino acid residues.
15671033 there is a 13-amino acid region within CN that is essential for the interaction with NFAT and with two other CN-binding proteins, AKAP79 and Cabin-1
15063762 Observational study of gene-disease association. (HuGE Navigator)
12700764 Crystal structure of the MADS-box/MEF2S domain of human MEF2B bound to a motif of the transcriptional co-repressor Cabin1 and DNA at 2.2 A resolution

AA Sequence

MIRIAALNASSTIEDDHEGSFKSHKTQTKEAQEAEAFALYHKALDLQKHDRFEESAKAYHELLEASLLRE      1 - 70
AVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQREDLETAMEFYLEAVMLDSTDVNLWYKIGHVALRLIRI     71 - 140
PLARHAFEEGLRCNPDHWPCLDNLITVLYTLSDYTTCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRK    141 - 210
DSLRMFLKCDMSIHDVSVSAAETQAIVDEALGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAM    211 - 280
YNHLTTCEPPRPSLGKRIDLSDYQDPSQPLESSMVVTPVNVIQPSTVSTNPAVAVAEPVVSYTSVATTSF    281 - 350
PLHSPGLLETGAPVGDISGGDKSKKGVKRKKISEESGETAKRRSARVRNTKCKKEEKVDFQELLMKFLPS    351 - 420
RLRKLDPEEEDDSFNNYEVQSEAKLESFPSIGPQRLSFDSATFMESEKQDVHEFLLENLTNGGILELMMR    421 - 490
YLKAMGHKFLVRWPPGLAEVVLSVYHSWRRHSTSLPNPLLRDCSNKHIKDMMLMSLSCMELQLDQWLLTK    491 - 560
GRSSAVSPRNCPAGMVNGRFGPDFPGTHCLGDLLQLSFASSQRDLFEDGWLEFVVRVYWLKARFLALQGD    561 - 630
MEQALENYDICTEMLQSSTAIQVEAGAERRDIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLEEIQRLY    631 - 700
EAGDYKAVVHLLRPTLCTSGFDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDYRQCFECSDVALNEAVQQ    701 - 770
MVNSGEAAAKEEWVATVTQLLMGIEQALSADSSGSILKVSSSTTGLVRLTNNLIQVIDCSMAVQEEAKEP    771 - 840
HVSSVLPWIILHRIIWQEEDTFHSLCHQQQLQNPAEEGMSETPMLPSSLMLLNTAHEYLGRRSWCCNSDG    841 - 910
ALLRFYVRVLQKELAASTSEDTHPYKEELETALEQCFYCLYSFPSKKSKARYLEEHSAQQVDLIWEDALF    911 - 980
MFEYFKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTERPALSLDKVSAYIEGTSTEVPCLPEGADPS    981 - 1050
PPVVNELYYLLADYHFKNKEQSKAIKFYMHDICICPNRFDSWAGMALARASRIQDKLNSNELKSDGPIWK   1051 - 1120
HATPVLNCFRRALEIDSSNLSLWIEYGTMSYALHSFASRQLKQWRGELPPELVQQMEGRRDSMLETAKHC   1121 - 1190
FTSAARCEGDGDEEEWLIHYMLGKVAEKQQQPPTVYLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEA   1191 - 1260
LEVYFRLHASILKLLGKPDSGVGAEVLVNFMKEAAEGPFARGEEKNTPKASEKEKACLVDEDSHSSAGTL   1261 - 1330
PGPGASLPSSSGPGLTSPPYTATPIDHDYVKCKKPHQQATPDDRSQDSTAVALSDSSSTQDFFNEPTSLL   1331 - 1400
EGSRKSYTEKRLPILSSQAGATGKDLQGATEERGKNEESLESTEGFRAAEQGVQKPAAETPASACIPGKP   1401 - 1470
SASTPTLWDGKKRGDLPGEPVAFPQGLPAGAEEQRQFLTEQCIASFRLCLSRFPQHYKSLYRLAFLYTYS   1471 - 1540
KTHRNLQWARDVLLGSSIPWQQLQHMPAQGLFCERNKTNFFNGIWRIPVDEIDRPGSFAWHMNRSIVLLL   1541 - 1610
KVLAQLRDHSTLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSERPGPKVCG   1611 - 1680
LPGARMTTDVSHKASPEDGQEGLPQPKKPPLADGSGPGPEPGGKVGLLNHRPVAMDAGDSADQSGERKDK   1681 - 1750
ESPRAGPTEPMDTSEATVCHSDLERTPPLLPGRPARDRGPESRPTELSLEELSISARQQPTPLTPAQPAP   1751 - 1820
APAPATTTGTRAGGHPEEPLSRLSRKRKLLEDTESGKTLLLDAYRVWQQGQKGVAYDLGRVERIMSETYM   1821 - 1890
LIKQVDEEAALEQAVKFCQVHLGAAAQRQASGDTPTTPKHPKDSRENFFPVTVVPTAPDPVPADSVQRPS   1891 - 1960
DAHTKPRPALAAATTIITCPPSASASTLDQSKDPGPPRPHRPEATPSMASLGPEGEELARVAEGTSFPPQ   1961 - 2030
EPRHSPQVKMAPTSSPAEPHCWPAEAALGTGAEPTCSQEGKLRPEPRRDGEAQEAASETQPLSSPPTAAS   2031 - 2100
SKAPSSGSAQPPEGHPGKPEPSRAKSRPLPNMPKLVIPSAATKFPPEITVTPPTPTLLSPKGSISEETKQ   2101 - 2170
KLKSAILSAQSAANVRKESLCQPALEVLETSSQESSLESETDEDDDYMDI                       2171 - 2220
//

Text Mined References (41)

PMID Year Title
27871933 2016 A Molecular Prospective for HIRA Complex Assembly and H3.3-Specific Histone Chaperone Function.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23939952 2014 EBV-encoded LMP-1 sensitizes nasopharyngeal carcinoma cells to genotoxic drugs by down-regulating Cabin1 expression.
23624525 2013 Genome-wide association analyses in Han Chinese identify two new susceptibility loci for amyotrophic lateral sclerosis.
23303793 2013 Phosphorylation and ubiquitination-dependent degradation of CABIN1 releases p53 for transactivation upon genotoxic stress.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22401310 2012 Identification of an ubinuclein 1 region required for stability and function of the human HIRA/UBN1/CABIN1/ASF1a histone H3.3 chaperone complex.
22275266 2012 Regulation of inflammatory responses and fibroblast-like synoviocyte apoptosis by calcineurin-binding protein 1 in mice with collagen-induced arthritis.
21807893 2011 Human CABIN1 is a functional member of the human HIRA/UBN1/ASF1a histone H3.3 chaperone complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20075944 2010 A case-control association analysis of CABIN1 with schizophrenia in a Japanese population.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19717561 2009 Calcineurin inhibitor protein (CAIN) attenuates Group I metabotropic glutamate receptor endocytosis and signaling.
19668210 2009 Cabin1 restrains p53 activity on chromatin.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17531200 2007 A new calcineurin inhibition domain in Cabin1.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15902271 2005 Calmodulin-dependent protein kinase IV regulates nuclear export of Cabin1 during T-cell activation.
15683985 2005 Selection of choriocarcinoma-associated genes using bioinformatics.
15671033 2005 The linker region joining the catalytic and the regulatory domains of CnA is essential for binding to NFAT.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
14718166 2004 Histone H3.1 and H3.3 complexes mediate nucleosome assembly pathways dependent or independent of DNA synthesis.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623296 2003 Endogenous protein inhibitors of calcineurin.
12700764 2003 Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714752 2001 Deletion of calcineurin and myocyte enhancer factor 2 (MEF2) binding domain of Cabin1 results in enhanced cytokine gene expression in T cells.
10933397 2000 Cabin1 represses MEF2-dependent Nur77 expression and T cell apoptosis by controlling association of histone deacetylases and acetylases with MEF2.
10931822 2000 The calcineurin-binding protein cain is a negative regulator of synaptic vesicle endocytosis.
10825153 2000 Calcium regulates transcriptional repression of myocyte enhancer factor 2 by histone deacetylase 4.
10591208 1999 The DNA sequence of human chromosome 22.
10531067 1999 Apoptosis of T cells mediated by Ca2+-induced release of the transcription factor MEF2.
9655484 1998 Cabin 1, a negative regulator for calcineurin signaling in T lymphocytes.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9150134 1997 Histone deacetylases associated with the mSin3 corepressor mediate mad transcriptional repression.