Property Summary

Ligand Count 454
NCBI Gene PubMed Count 14
PubMed Score 220.53
PubTator Score 38.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
active Crohn's disease -1.987 3.2e-03
ulcerative colitis -2.300 3.9e-06

Gene RIF (6)

AA Sequence

MTGHHGWGYGQDDGPSHWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELSYEACMSLSITNNGHSVQV      1 - 70
DFNDSDDRTVVTGGPLEGPYRLKQFHFHWGKKHDVGSEHTVDGKSFPSELHLVHWNAKKYSTFGEAASAP     71 - 140
DGLAVVGVFLETGDEHPSMNRLTDALYMVRFKGTKAQFSCFNPKCLLPASRHYWTYPGSLTTPPLSESVT    141 - 210
WIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFRPPQPLKGRVVKASFRA                    211 - 264
//

Text Mined References (21)

PMID Year Title