Property Summary

NCBI Gene PubMed Count 324
PubMed Score 614.68
PubTator Score 521.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Amyotrophic lateral sclerosis 451 7.572 3.8
Motor neuron disease 49 0.0 3.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (14)

Disease log2 FC p
Alzheimer's disease -1.400 2.9e-02
adrenocortical carcinoma -1.545 1.5e-03
atypical teratoid / rhabdoid tumor -1.100 2.4e-03
Breast cancer -1.400 1.2e-17
chronic rhinosinusitis -1.469 3.1e-02
gastric cancer -1.300 1.0e-03
hepatocellular carcinoma -1.200 4.4e-06
intraductal papillary-mucinous adenoma (... -1.100 1.2e-02
intraductal papillary-mucinous carcinoma... -1.300 4.9e-03
oligodendroglioma -1.200 5.0e-02
ovarian cancer -1.300 2.5e-05
Pick disease -1.300 1.2e-02
posterior fossa group B ependymoma 1.300 8.5e-05
tuberculosis and treatment for 3 months 1.100 3.3e-03

Gene RIF (301)

AA Sequence

MSTLCPPPSPAVAKTEIALSGKSPLLAATFAYWDNILGPRVRHIWAPKTEQVLLSDGEITFLANHTLNGE      1 - 70
ILRNAESGAIDVKFFVLSEKGVIIVSLIFDGNWNGDRSTYGLSIILPQTELSFYLPLHRVCVDRLTHIIR     71 - 140
KGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEIDIADTVLNDDD    141 - 210
IGDSCHEGFLLNAISSHLQTCGCSVVVGSSAEKVNKIVRTLCLFLTPAERKCSRLCEAESSFKYESGLFV    211 - 280
QGLLKDSTGSFVLPFRQVMYAPYPTTHIDVDVNTVKQMPPCHEHIYNQRRYMRSELTAFWRATSEEDMAQ    281 - 350
DTIIYTDESFTPDLNIFQDVLHRDTLVKAFLDQVFQLKPGLSLRSTFLAQFLLVLHRKALTLIKYIEDDT    351 - 420
QKGKKPFKSLRNLKIDLDLTAEGDLNIIMALAEKIKPGLHSFIFGRPFYTSVQERDVLMTF             421 - 481
//

Text Mined References (325)

PMID Year Title