Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.763 0.000
psoriasis -1.100 0.000

AA Sequence

MVLAMLGALHPRAGLSLFLHLILAVALLRSQPLRSQRSVPEAFSAPLELSQPLSGLVDDYGILPKHPRPR      1 - 70
GPRPLLSRAQQRKRDGPDLAEYYYDAHL                                               71 - 98
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
11181995 2001 The sequence of the human genome.