Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.06
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MRGTSCVGGGAESPGGAGLSEGPRGRWLRLAPVCAYFLCVSLAAVLLAVYYGLIWVPTRSPAAPAGPQPS      1 - 70
APSPPCAARPGVPPVPAPAAASLSCLLGVPGGPRPQLQLPLSRRRRYSDPDRRPSRQTPRETPEAAEGRR     71 - 140
PG                                                                        141 - 142
//

Text Mined References (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.