Property Summary

NCBI Gene PubMed Count 2
Grant Count 2
R01 Count 2
Funding $204,593.33
PubMed Score 57.15
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
interstitial cystitis 1.200 0.000

Synonym

Accession C9JUS6
Symbols AM5
C19orf76

Gene

 Grant Application (2)

AA Sequence

MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLHQGALGEGQPR      1 - 70
APGPLQLWAPPVARGGSPARFPGFRPAARGLAQCPARWVTSGTARPLLGFSLPICMLELLLHISSPLTPA     71 - 140
PETVFPSPSPGCD                                                             141 - 153
//

Text Mined References (4)

PMID Year Title
18434369 2008 Central and peripheral cardiovascular actions of adrenomedullin 5, a novel member of the calcitonin gene-related peptide family, in mammals.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.