Property Summary

NCBI Gene PubMed Count 2
PubMed Score 60.92
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (1)

Disease log2 FC p
interstitial cystitis 1.200 3.3e-04

AA Sequence

MTIHILILLLLLAFSAQGDLDTAARRGQHQVPQHRGHVCYLGVCRTHRLAEIIYWIRCLHQGALGEGQPR      1 - 70
APGPLQLWAPPVARGGSPARFPGFRPAARGLAQCPARWVTSGTARPLLGFSLPICMLELLLHISSPLTPA     71 - 140
PETVFPSPSPGCD                                                             141 - 153
//

Text Mined References (4)

PMID Year Title