Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.18
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
interstitial lung disease -1.300 1.1e-02
Waldenstrons macroglobulinemia 1.591 1.1e-02
Multiple myeloma 2.258 5.8e-05
psoriasis 1.700 6.7e-08
glioblastoma 1.300 2.3e-02
medulloblastoma, large-cell -1.400 1.0e-05
juvenile dermatomyositis 1.736 1.8e-13
intraductal papillary-mucinous neoplasm ... -1.700 3.2e-02
diabetes mellitus -1.200 1.8e-03
group 3 medulloblastoma 1.600 7.6e-03
subependymal giant cell astrocytoma 1.242 1.0e-02
inflammatory breast cancer 1.100 1.2e-03
ovarian cancer -1.500 2.1e-04

Synonym

Accession Q9GZU0 Q3LIB6 Q5JVZ2 Q5JVZ3 Q6IA63 Q9H1Z2
Symbols XTP12
dJ30M3.2
Nbla00237

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGDPNSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKG      1 - 70
VRDSSYSLESSLELLQKDVVQLHAPRYQSMRRDVIGCTQEMDFILWPRNDIEKIVCLLFSRWKESDEPFR     71 - 140
PVQAKFEFHHGDYEKQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQ    141 - 210
LTHWAVGTIEDHLRPYMPE                                                       211 - 229
//

Text Mined References (7)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.