Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.18
PubTator Score 0.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
diabetes mellitus -1.200 1.8e-03
glioblastoma 1.300 2.3e-02
group 3 medulloblastoma 1.100 1.2e-02
inflammatory breast cancer 1.100 1.2e-03
interstitial lung disease -1.300 1.1e-02
intraductal papillary-mucinous neoplasm ... -1.700 3.2e-02
juvenile dermatomyositis 1.736 1.8e-13
medulloblastoma, large-cell -1.400 1.0e-05
Multiple myeloma 2.258 5.8e-05
ovarian cancer -1.500 2.1e-04
psoriasis 1.700 6.7e-08
subependymal giant cell astrocytoma 1.242 1.0e-02
Waldenstrons macroglobulinemia 1.591 1.1e-02

AA Sequence

MGDPNSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKG      1 - 70
VRDSSYSLESSLELLQKDVVQLHAPRYQSMRRDVIGCTQEMDFILWPRNDIEKIVCLLFSRWKESDEPFR     71 - 140
PVQAKFEFHHGDYEKQFLHVLSRKDKTGIVVNNPNQSVFLFIDRQHLQTPKNKATIFKLCSICLYLPQEQ    141 - 210
LTHWAVGTIEDHLRPYMPE                                                       211 - 229
//

Text Mined References (7)

PMID Year Title