Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.08
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Down syndrome 499 3.232 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.900 4.7e-02
atypical teratoid / rhabdoid tumor -1.100 7.4e-04
medulloblastoma, large-cell -1.600 5.1e-07
osteosarcoma -1.021 1.4e-02
ovarian cancer 1.100 1.1e-02

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFYNIFSLRLPGL      1 - 70
LLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQ     71 - 140
SFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDLLIGEDKEAGTETVMRILLKK    141 - 210
VFEEKTESEKYRVVLRRWKSLKLPKKRMSK                                            211 - 240
//

Text Mined References (15)

PMID Year Title