Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.200 1.1e-04
non primary Sjogren syndrome sicca -1.300 3.0e-02
ovarian cancer 1.500 8.5e-10

Synonym

Accession C9J3I9
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MREIAEILPAQEKVEARIDLKMGKKRVTDHKLNVDKVIKNINTISSELKKIKELSQLLLCDLILHFNHPI      1 - 70
KTENLAEAERNNPLFEESKISDVSLVSNSFSI                                           71 - 102
//

Text Mined References (4)

PMID Year Title