Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.17
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Synonym

Accession C9J302
Symbols

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 Compartment GO Term (0)

AA Sequence

MSHYFYLTPQILLPFSPLTSQEFDLIRRKAGASWQDETRWSDSSVTTYTGSYRKKQLDKSMCSQFSFRAG      1 - 70
QHEPECKQMSLTNSSACHLLCWAGTQETTDIKGLFPDITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYG     71 - 140
KYCVRPKKPAQEALINYSRRGKGVLKHLHGRCDSESKVCSSEDSEADRYSDYGWGGPSSPFN            141 - 202
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.