Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (1)

AA Sequence

MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKL      1 - 70
LEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD                                71 - 113
//

Text Mined References (8)

PMID Year Title